KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6417Help
Entry
SHJG_6417         CDS       T02063                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:shy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SHJG_6417
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:shy03400]
    SHJG_6417
Enzymes [BR:shy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SHJG_6417
DNA repair and recombination proteins [BR:shy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SHJG_6417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEY91684
UniProt: H2K3Y8
LinkDB All DBs
Position
complement(7300376..7301245)
Genome map
AA seq 289 aa AA seqDB search
MEGRRVALSNLEKVLYPETGFTKGELLHYYATTATALLPHLRDRAVSFLRYPDGPEGQLF
FTKNVPPGTPEWVTTAEVPRSSADSPARMVVVQDLPSLVWAANLVTEFHTHQWLVRSPQE
ADRLVFDLDPGAPATVVHCCEVALWLRERLAADGIVAYPKTAGSKGLHLLAAVRGSSSEG
TSDYAKALAVEAERAMPRLVVHRMTKSLRPGKVFVDWSQNAARKTTATPYTVRARRLPLV
SAPVTWEEVADCRSPGQLEIHAEDMAPRLQDHGDLMEPLLDRRSAAPLP
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtggaggggcgccgggtcgcgctcagcaacctggagaaggtgctgtatccggagaccggc
ttcaccaaaggggagctgctgcactactacgcgaccaccgccacggccctgctgccgcac
ctgcgcgaccgggcggtgtccttcctgcgctatccggacgggcccgaagggcagctcttc
ttcacgaagaacgtgccgccgggtacgcccgagtgggtcaccacggccgaggtgccgcgg
tcgtcggcggacagcccggcccggatggtcgtggtgcaggacctgccgagcctggtctgg
gcggcgaacctcgtcaccgagttccacacccaccagtggctggtgcggtccccgcaggag
gcggaccggctggtcttcgacctcgatccgggcgcgcccgcgacggtcgtgcactgctgc
gaggtcgccctgtggctgcgggagcggctcgcggcggacgggatcgtggcgtacccgaag
accgcggggtcgaaggggctgcatctgctggcggcggtgcgcgggagttcttccgagggg
acgtccgattacgcgaaggcgctggcggtggaggccgagcgggcgatgccccggctggtg
gtgcaccggatgacgaagagcctgcggccggggaaggtgttcgtcgactggagccagaac
gctgcgcgcaagaccacggccaccccgtacaccgtgcgcgcccgccgcctccccctggtg
tccgcgccggtgacctgggaggaggtggccgactgccggagccccgggcagctggagatc
cacgcggaggacatggcgccgcgcttgcaggatcacggggacctgatggagccgttgctg
gaccggcggtcggcggccccgttgccgtaa

DBGET integrated database retrieval system