KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7399Help
Entry
SHJG_7399         CDS       T02063                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00250  Alanine, aspartate and glutamate metabolism
shy00410  beta-Alanine metabolism
shy00640  Propanoate metabolism
shy00650  Butanoate metabolism
shy01100  Metabolic pathways
shy01120  Microbial metabolism in diverse environments
Module
shy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SHJG_7399
   00650 Butanoate metabolism
    SHJG_7399
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SHJG_7399
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SHJG_7399
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shy01007]
    SHJG_7399
Enzymes [BR:shy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SHJG_7399
Amino acid related enzymes [BR:shy01007]
 Aminotransferase (transaminase)
  Class III
   SHJG_7399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEY92666
UniProt: H2JMA5
LinkDB All DBs
Position
8430849..8432132
Genome map
AA seq 427 aa AA seqDB search
MNDLYSRHRRVLPDWLALYYDDPIELSHGEGRHVWDTAGRRYLDFFGGILTTLTAHALPE
VTKAVSEQAGRIIHSSTLYLNRPMVELAERIAQVSGIPDARVFFTTSGTEANDTALLLAT
TYRRSNTVLAMRNSYHGRSFSAIGVTGNRGWSPTSLSPLQTLYVHGGVRTRGPFAHLDDR
AFIDACVADLKDVLGHTRPPAALIAEPVQGVGGFTSPPDSLYASFREVLKEHGVLWIADE
VQTGWGRTGDHFWGWQAHARSGPPDIVTFAKGIGNGMSIGGVIARSEIMNCLDANSISTF
GGTQITMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAVGAQLPGVREVRGRGLMIGVE
LVRPGTDEADPQAVAAVLEAAREGGLLLGKGGGHDTSALRISPPLSLTVAEAEEGAAILE
QALRSTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacctctactcccgccaccgcagggtcctgcccgactggctcgccctctactac
gacgacccgatcgagctcagccacggcgaggggcgccacgtctgggacaccgccggccgg
cggtacctggacttcttcggcggcatcctgaccacgctgaccgcgcacgccctgcccgag
gtgaccaaggcggtcagcgagcaggccggccggatcatccactcctccaccctctacctc
aaccggccgatggtcgaactcgccgagcggatcgcccaggtgagcggaatcccggacgcc
cgcgtgttcttcacgacctccggcaccgaggccaacgacaccgccctgctgctcgccacc
acctaccggcgcagcaacaccgtcctcgccatgcggaacagctaccacggccgctccttc
agcgcgatcggcgtcaccggcaaccgcggctggtccccgacctccctctccccgctccag
accctgtacgtccacggcggcgtacgcacccgggggccgttcgcccacctcgacgaccgc
gcgttcatcgacgcctgtgtcgccgacctgaaggacgtcctcggccacacccggccgccg
gccgcgctgatcgccgaacccgtccagggcgtcggcgggttcacctccccgccggacagt
ctctacgcctccttccgggaggtgctgaaggagcacggcgtcctgtggatcgccgacgag
gtgcagaccggctggggccgcaccggcgaccacttctggggctggcaggcgcacgcccgc
agcggcccgccggacatcgtcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggggtcatcgcccgttccgagatcatgaactgcctggacgccaacagcatctccaccttc
ggcggcacccagatcaccatggccgccggcctcgccaacctcacctacctcctcgaacac
gacctccagggcaacgcccggcgcgtcggcggcctgctcatcgagcggttgcgggcggtc
ggcgcgcagctgcccggggtgcgggaagtgcgcggacgcgggctgatgatcggcgtcgag
ctggtcagaccgggcacggacgaggccgacccgcaggccgtcgcggcggtgctggaggcg
gcccgggagggcgggctgctcctcggcaagggcggcgggcacgacaccagcgccctgcgg
atcagcccgccgctgtcgctgacggtcgccgaggccgaggagggcgcggcgatcctggaa
caggcgctgaggagcacgtactag

DBGET integrated database retrieval system