KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7759Help
Entry
SHJG_7759         CDS       T02063                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00020  Citrate cycle (TCA cycle)
shy00480  Glutathione metabolism
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01130  Biosynthesis of antibiotics
shy01200  Carbon metabolism
shy01210  2-Oxocarboxylic acid metabolism
shy01230  Biosynthesis of amino acids
Module
shy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SHJG_7759
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SHJG_7759
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SHJG_7759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF3322 Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: AEY93026
UniProt: H2JTF0
LinkDB All DBs
Position
complement(8824032..8826251)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTYTDEAPALATHSFLPVIQAYASQAGVPVETRDISLAGRIIAVFPEYLNEDQ
RIPDALTELGELAKTPAANIIKLPNISASIPQLKAAVAELQGKGYALPDYPDDPKTDEER
EIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWSGESKTNVATMGEND
FRSTEKSVVVSEDGALKIELVGEDGTTTVLKESVPVLAGEVVDASVMRVAELNSFLAAQV
ARAKQEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFARYGETLKAAGLTPNDGLGGI
LKGLENLPEGAEIKASFEAEIAEGPALAMVDSDKGITNLHVPSDVIIDASMPAMIRTSGH
MWGPDGQEHDALAVIPDSSYAGVYQAVIEDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPAAGTVRLTDQAGNVLIEQPVAQGDIFRACQTKDDPIRDWVKLAVTRARATGD
PAVFWLDETRAHDAQLIAKVKQYLPEHDTEGLDIRILSPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSFEQYAAATGNTRAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAGQTEDADLAKAFAPLAETLAANEQKIVEELNAVQGSPADIGGYYQVDKAK
ADAVMRPSATWNEALASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacctacacagacgaggccccggccctggcgacgcat
tcgttcctgccggtgatccaggcgtacgcctcgcaggccggtgtgcccgtggagacgcgt
gacatctcgctggccgggcgcatcatcgccgtcttcccggagtacctgaacgaggaccag
cgcatccccgacgcgctgaccgagctgggcgagctggccaagacccccgcggccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctgaaggccgccgtcgccgagctc
cagggcaagggctacgcgctgccggactacccggacgaccccaagaccgacgaggagcgc
gagatccgcgcccgctacgacaaggtcaagggctccgccgtcaacccggtgctgcgcgag
ggcaactccgaccgccgtgccccggcctcggtgaagaactacgccaagacccacccgcac
cgcatgggcgcctggagcggcgagtccaagaccaatgtggcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgtcgtcgtctccgaggacggcgccctgaagatcgagctg
gtcggcgaggacggcaccaccaccgtcctgaaggagtccgtgccggtcctcgcgggcgag
gtcgtcgacgcgtccgtcatgcgcgtcgccgagctgaactcgttcctggccgcgcaggtc
gcccgcgccaagcaggagggcgtcctgttctccgtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggtcacgtggtgcgcgccttcttcccgaagacgttcgcg
cggtacggcgagaccctcaaggcggccggcctcaccccgaacgacggcctcggcggcatc
ctgaagggcctggagaacctgcccgagggcgccgagatcaaggcctccttcgaggccgag
atcgccgagggccccgccctggccatggtcgactcggacaagggcatcaccaacctgcac
gtgccctccgacgtcatcatcgacgcctccatgccggccatgatccgcacctccggccac
atgtggggcccggacggccaggagcacgacgccctcgccgtcatcccggactcctcctac
gccggtgtctaccaggccgtcatcgaggactgccgggccaacggcgcctacgacccgtcc
accatgggctcggtcccgaacgtcggcctgatggcgcagaaggccgaggagtacggctcc
cacgacaagaccttcgagatcccggccgccggcacggtccggctgaccgaccaggccggc
aacgtgctgatcgagcagccggtcgcgcagggcgacatcttccgcgcctgccagaccaag
gacgacccgatccgcgattgggtcaagctggccgtcacccgcgcccgggccaccggcgac
ccggccgtgttctggctggacgagacgcgcgcccacgacgcgcagctgatcgccaaggtc
aagcagtacctgccggagcacgacaccgagggcctggacatccgcatcctgtccccggtc
gaggccaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtgacc
ggcaacgtgctgcgtgactacctgaccgacctcttccccatcctggagttgggcaccagc
gccaagatgctgtcggtcgtgccgctgatggcgggcggcggcctgttcgagacgggcgcc
ggcggctccgcgccgaagcacgtccagcagctcgtcaaggagaactacctgcgctgggac
tccctcggcgagttcttcgccctggtgccgtccttcgagcagtacgcggcggccaccggc
aacacccgcgccaaggtcctcgccgacaccctggaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccggcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggccgggcagaccgaggacgccgacctcgcgaag
gcgttcgcgccgctcgccgagaccctcgccgcgaacgagcagaagatcgtcgaggagctg
aacgcggtccagggctccccggccgacatcggcggctactaccaggtcgacaaggccaag
gcggacgcggtcatgcggccgtcggccacctggaacgaggcgctggcgtccctgagctag

DBGET integrated database retrieval system