KEGG   Sphingobium hydrophobicum: CJD35_00270Help
Entry
CJD35_00270       CDS       T05146                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shyd  Sphingobium hydrophobicum
Pathway
shyd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:shyd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CJD35_00270
Enzymes [BR:shyd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CJD35_00270
Transporters [BR:shyd02000]
 Other Transporters
  Pores ion channels [TC:1]
   CJD35_00270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ASY43062
UniProt: A0A249MP18
LinkDB All DBs
Position
I:56934..57557
Genome map
AA seq 207 aa AA seqDB search
MTLTFYTNPMSRGQIVRWMLEEVGVPYDPVLLDYATTMKAPDYLAINPMGKVPAIVHNGT
IVTECAAICAYLADAFPAANLAPPAQARGAYYRWLFFAAGPLEAAITNNAMGFVLPEGRE
RTAGYGSLDDVLNTLEQAVAGEAWICGDQFTAADVYVGSQIDWGLSFGTVPERPAFTAYA
ERLRARPAYKRQKEIDGALIAAMQNQG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcaccttctacaccaaccccatgtcgcgcgggcagatcgtccgctggatgctg
gaggaagttggcgtcccctatgaccccgtcctgctcgactatgcgacgaccatgaaggct
cccgactatctcgcgatcaacccgatgggcaaggtacccgcgatcgtccataacggtacc
atcgtcaccgaatgtgccgccatctgcgcctatctcgccgatgctttccccgccgccaac
ctcgccccgccagcccaagcacgcggcgcctattatcgctggctcttcttcgcggccggg
ccgctcgaagccgcgatcaccaacaacgccatgggcttcgtcctgccggaagggcgcgaa
cggaccgcaggctatggctcgctcgacgacgtgctaaatacgctcgaacaggcggtggcg
ggcgaggcatggatttgcggcgaccagttcaccgccgccgacgtctatgtggggtctcag
attgattggggcctgtccttcggcaccgtgccggagcggcccgccttcaccgcctatgcg
gaacgcctgcgcgcgcgccccgcctataagcggcaaaaggagatcgacggcgccctgatc
gcggcgatgcagaaccagggttaa

DBGET integrated database retrieval system