KEGG   Sphingobium hydrophobicum: CJD35_03410Help
Entry
CJD35_03410       CDS       T05146                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
shyd  Sphingobium hydrophobicum
Pathway
shyd00620  Pyruvate metabolism
shyd00680  Methane metabolism
shyd01100  Metabolic pathways
shyd01120  Microbial metabolism in diverse environments
shyd01200  Carbon metabolism
Module
shyd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:shyd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CJD35_03410
  09102 Energy metabolism
   00680 Methane metabolism
    CJD35_03410
Enzymes [BR:shyd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CJD35_03410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 ACT_5
Motif
Other DBs
NCBI-ProteinID: ASY43610
UniProt: A0A249MQI2
LinkDB All DBs
Position
I:complement(690566..693268)
Genome map
AA seq 900 aa AA seqDB search
MATLSSSPSAPAITQNPDIRYLGRLLGDVIRAYGGDSLYRQTEYIRSASVDRARGIQGAD
LVDTGLDALSLDDTLNFTRGFMLFSMLANLAEDRQGVAADPGADVASAIARLDSHGIDRD
AVLGLLAHSLIVPVLTAHPTEVRRKSMIDHKNRIADLMLLKDAGRQETAHGENLDEAIFR
QIALLWQTRPLRREKLFVADEIDNVLTYFRDIFLPVLPALYTRWERVLGARPQSFLRVGS
WIGGDRDGNPFVQAPQLEFALKRGAQAALAYYLDALHALGAELSLSTELAHVPQAVLDIA
DASGDESPSRQDEPYRRAISGIYARLVATYVALTGDQPPRPSSLKGQAYASPADFRRDLV
TVAQGLASEGNGALATGGALGRLIRAVETFGFHLATLDMRQNSDVHQRVVAELLKVAGVE
PDYAALDEYARIALLRRELANNRPLGSRFSDYSEETASELAIVHAAAEAHRIYGPACITH
YIISKAESVSDLLEVNILLKEAGLWRAGVEGSPPQASIMSIPLFETIADLEAAPQIMSAY
FGLPEIAGVVKQRGHQEVMIGYSDSNKDGGYITSTWSLFKASKALEPVFAEASAAMQLFH
GRGGAVGRGGGSAFAAIQAQPRGTVQGRIRITEQGEMIAAKFGSRDVAMTNLEAMTSATL
LASLEPEGISDKDAARFAGAMDELSQNAFNAYRDLVYGTDGFKEFFRQLTPIQEIAGLKI
GSRPASRTKSDRIEDLRAIPWVFSWAQARVMLPGWYGVGHAIAAFEDKALLADMAQSWSF
LKSAMGNLEMVLAKSDLGIAARYLPLVEDQAMAERLFGRIREGWALTHDGLMAATGQSRL
LEKNPTLETSIRLRLPYIEPLNLLQVELLKRHRAGEDDPRIKEGIELSINAVATALRNSG
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcgactctctcctcatcaccgtccgctcctgcgatcacgcagaaccccgacatccgc
tatctggggcgcctgctgggcgatgtgattcgcgcctatggcggggatagcctctatcgc
cagaccgaatatatccgctccgcctcggtcgatcgggcgcgcggcatacagggcgcggac
cttgtcgataccgggctggacgcgctcagcctcgacgacacgctcaacttcacccgcggc
ttcatgctgttttcgatgctcgccaatctggccgaggaccggcagggggtcgcggcggac
ccaggggccgatgtggcgtcggcgatcgcccggctcgattcgcacggaattgatcgtgac
gcggttctggggctgctggcgcattcgctgatcgtccccgttctcaccgcccacccgacc
gaggtgcggcgcaagagcatgatcgatcacaagaatcgcattgccgatctgatgctgctc
aaggatgcgggtcgccaggaaacggctcacggcgaaaatctggatgaggcgatttttcgc
cagatcgccctgctgtggcaaacccgtccgctgcgccgtgaaaaactgttcgtcgcggac
gagatcgacaatgtgctcacctatttccgcgacatattcctgcctgtcctgcccgccctt
tatacgcggtgggagcgggtgctgggcgcgcgcccgcaaagcttcctgcgggtcggcagc
tggatcggcggcgaccgcgacggcaatcccttcgtgcaggcgccccaactggaattcgcg
ctcaagcggggggcgcaggcggcgctcgcttattatctcgatgcgctgcatgcgctaggc
gcggaactctcgctgtctaccgaactcgcccatgtgccgcaggcggtgctggatattgcc
gacgccagcggagacgagtcgcccagtcggcaggacgaaccctatcgccgcgccatttcg
ggcatctacgcccggctcgtcgccacctatgtggcgttgaccggggatcagcctccgcgt
ccctccagcctgaaagggcaggcctatgccagccccgccgatttccgccgcgatctcgtc
accgtggcccaagggctggcgagcgagggcaatggcgcgctggcgaccgggggcgcgctt
ggccgtctgatccgtgcggtcgaaaccttcggcttccatcttgccacgctcgacatgcgt
cagaatagcgacgtgcatcagcgcgtcgttgcggaactgctgaaggtagcgggggtcgag
ccggactatgccgcgctcgacgaatatgcccgtatcgcgctgctgcgccgggaactggcc
aataaccgcccgctggggtcgcgcttttccgactattcggaggaaaccgcgtcggaactg
gcgatcgtccatgccgccgccgaagcgcaccgcatctatggccccgcctgcatcacccat
tatatcatttccaaggcggaaagcgtgtcggacctgctggaggtcaacatcctgctcaag
gaagccggcctgtggcgcgccggcgtagaaggttcgccgccccaggcgtcgatcatgtcg
attccgctgtttgaaaccatcgccgatctggaagctgcgccgcagatcatgtcggcctat
ttcggcctgcccgaaatagctggcgtcgtgaagcagcgcggccatcaggaagtgatgatc
ggctattcggacagcaacaaggatggtggctacatcacatcgacctggagcctgttcaag
gcaagcaaggcgctggagccggtctttgccgaagccagcgcggcaatgcagctgttccat
gggcgtggcggcgcggtcgggcgcggcggtggttccgccttcgccgcgatccaggctcag
ccgcgcggcaccgtgcaggggcgcatccgcatcaccgaacagggggagatgatcgccgcc
aaattcggatcgcgcgacgtcgccatgaccaatttggaggcgatgacgagcgcgaccctg
ctcgccagtctggaacccgaaggcatttcggacaaggacgcagcgcgttttgcaggcgcc
atggacgaactgtcgcaaaacgccttcaatgcctatcgcgatctggtctacgggacggac
ggcttcaaggaattcttccggcagctaaccccgattcaggagattgcgggcctcaagatc
ggctcccgccccgccagccgcaccaaaagcgaccggatcgaggatttgcgcgccatcccc
tgggtgttcagttgggcgcaggcgcgcgtcatgctgccgggctggtatggcgttggccat
gcgatcgcagccttcgaggacaaggcgctgctcgccgacatggcgcaaagctggtctttc
ctgaagtcggccatgggcaatctggaaatggtgctggccaaatcggatctgggcattgcg
gcgcgctatctgccgctggtcgaggatcaggcgatggccgaacggctgtttggccgtatc
cgtgaaggctgggcattgacccatgacgggctgatggccgcaaccgggcagagccgtctg
ctggaaaagaatccgacgctggaaacgtccatccggctccgactgccttatatcgaaccg
ctcaacctgcttcaggtcgaactgttgaagcgccaccgcgcgggcgaggatgatccgcgg
atcaaggaaggtatcgaattgtcgatcaacgccgtcgcgacggccctgcgcaacagcgga
tga

DBGET integrated database retrieval system