KEGG   Sphingobium hydrophobicum: CJD35_08240Help
Entry
CJD35_08240       CDS       T05146                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
shyd  Sphingobium hydrophobicum
Brite
KEGG Orthology (KO) [BR:shyd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:shyd02022]
    CJD35_08240
Two-component system [BR:shyd02022]
 OmpR family
  Unclassified
   CJD35_08240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: ASY44430
UniProt: A0A249MSV0
LinkDB All DBs
Position
I:1703803..1704522
Genome map
AA seq 239 aa AA seqDB search
MSEKPHLLLVDDERSIREPLAQYLSRNGFRVTAVDSAAEARIRLNANAIDLVILDIMMPG
EDGLSLCRHIRETSEIPVILLTARAEETDRIVGLEMGADDYVLKPFSPRELVARIKVIFR
RVATGGQRVTAPDGANYSFAGWLLKTQERTLVDSEGVSLPLSTAEYNLMLAFATRPNSVL
SRDQLLDITQGREANAFDRAIDNQISRLRKKIEPDPKNPTLIKTVWGGGYTLSAEVRKL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaaaccccatctcctcctcgtcgatgacgagcgttcgatccgcgaaccgctg
gcgcaatatctctcgcgcaacggcttccgcgtcaccgccgtcgacagcgcggccgaagcg
cgcatccggctgaatgcgaacgcgatcgacctggtgatcctcgacatcatgatgccaggc
gaggatggcctgtcgctgtgccgccatatccgcgaaaccagcgagatcccggtgatcctg
ctgaccgcccgcgcagaggagaccgaccgcatcgtcgggctggaaatgggcgcggacgat
tatgtgctcaaacccttttcgccgcgtgaactggtcgcgcggatcaaggtgatctttcgc
cgcgtcgccaccggcggccagcgcgtcaccgcgcccgatggcgccaattacagtttcgcc
ggatggctgctcaagacgcaggaacgcacgctggtggatagcgagggcgtgtcgctgccg
ctttcgaccgccgaatataatctgatgctggcctttgccacgcgccccaacagcgtgctc
agccgcgaccagttgctcgacatcacccaggggcgtgaggccaatgccttcgaccgggcg
atcgacaatcagatcagccgcctgcgcaagaagatcgagccggaccccaaaaaccccacg
ctgatcaagaccgtgtggggcggcggctacaccctgtcggcggaagtccgcaaattgtga

DBGET integrated database retrieval system