KEGG   Sphingobium hydrophobicum: CJD35_10465Help
Entry
CJD35_10465       CDS       T05146                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shyd  Sphingobium hydrophobicum
Pathway
shyd00473  D-Alanine metabolism
shyd00550  Peptidoglycan biosynthesis
shyd01100  Metabolic pathways
shyd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shyd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CJD35_10465
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CJD35_10465
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CJD35_10465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shyd01011]
    CJD35_10465
Enzymes [BR:shyd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CJD35_10465
Peptidoglycan biosynthesis and degradation proteins [BR:shyd01011]
 Precursor biosynthesis
  Amino acid ligase
   CJD35_10465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ASY44826
UniProt: A0A249MU03
LinkDB All DBs
Position
I:2117637..2118599
Genome map
AA seq 320 aa AA seqDB search
MRGPWHVAVLMGGWSAERPVSLMSGEGVAKALESRGHRVTRIDMDRDVAARLAETKADVV
FNALHGVPGEDGTVQGMMDLMGLTYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGHIVQ
SESLFEGDPLPRPYVLKPVNEGSSVGVAIVTAEGNYGNPIARDSVGPWQDFPELLAEPYI
RGRELTTAVLGDEALLVTELRPKSGFYDFDAKYTDGMTEHVCPADIPDEITQACKALALR
SHQLLGCKGASRSDFRWDDERGVEGLFLLEVNTQPGMTPLSLVPEQAAKLGIDYATLVET
IVEEALAGARMPDRAGAKHG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcccttggcatgtcgccgtcctgatgggcggctggtcggcggagcggcctgtt
tccctcatgagcggggagggtgtagccaaggcgctggaatcgcgtgggcatcgagtcacg
cggatcgacatggaccgtgatgtcgcggcgcggttggcggaaacaaaagccgacgtcgtg
ttcaacgcgctgcatggcgtgccgggtgaggatggcaccgtgcaggggatgatggacctg
atggggctgacctacacccattcgggccttgccacttctgtcatcgcgatcgacaagcaa
ttgaccaaacaggcgctggtaccgcacggcattcccatgcccggcggccatatcgtgcag
agcgagagcctgttcgagggcgatccgctgccgcgtccctatgtattgaagcctgtcaat
gaaggcagttctgtcggcgtcgccatcgtcacggcggagggcaattatggcaaccccatc
gcgcgagacagtgtggggccatggcaggatttccccgaattgctggccgaaccctatatt
cgcgggcgtgaactgaccaccgccgtactgggcgacgaagcgctgctggtgacggagttg
cggcccaagagcggcttttatgatttcgatgccaaatataccgatggcatgacagagcat
gtctgccccgccgacattcccgacgagattacgcaggcgtgcaaggcgctggcgttgcgg
tcgcaccagttgctggggtgcaagggcgcatcgcggtccgatttccgctgggacgatgaa
cgcggcgtcgaggggctgttcctgctggaggtcaatacccagccgggcatgacgccgctg
agcctggttcccgaacaggcggcgaagctgggcattgactatgccacgctggtagagact
attgtcgaggaagcactggcaggtgcccggatgccggacagggcgggagcgaaacatggc
tga

DBGET integrated database retrieval system