KEGG   Sphingobium hydrophobicum: CJD35_13420Help
Entry
CJD35_13420       CDS       T05146                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
shyd  Sphingobium hydrophobicum
Pathway
shyd00010  Glycolysis / Gluconeogenesis
shyd00020  Citrate cycle (TCA cycle)
shyd00620  Pyruvate metabolism
shyd01100  Metabolic pathways
shyd01110  Biosynthesis of secondary metabolites
shyd01120  Microbial metabolism in diverse environments
shyd01130  Biosynthesis of antibiotics
shyd01200  Carbon metabolism
Module
shyd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shyd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJD35_13420
   00020 Citrate cycle (TCA cycle)
    CJD35_13420
   00620 Pyruvate metabolism
    CJD35_13420
Enzymes [BR:shyd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CJD35_13420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ASY45322
UniProt: A0A249MVK9
LinkDB All DBs
Position
I:complement(2768724..2770025)
Genome map
AA seq 433 aa AA seqDB search
MSKTIQMPALSPTMEEGTLAKWLVKEGDTVSSGDLLAEIETDKATMEFEAVDEGVIAKIL
VSEGSEGVKVGTVIAIIAEEGEDVEAAAAGGGKPAPKADPVPAKAEAAAPAAAAPKADAV
PAAPASSDKRVKASPLARRLAQSKGIDLAVVSGTGTNGRIVKSDLDGAKEGVAAPAAAPA
SAPAAKAEAAAPAPAAASGAQDFGIPHEVVKLSGMRKTIARRLTESKQQVPHIYLTVDIQ
LDKLLKLRSELNAGLASRKVKLSVNDLLIKALGVALMEVPECNVQFAGDQMLQFKRADIS
VAVSIPGGLITPIVTGADGKGVAAISTEMKDLADRAKAGKLSPNEYQGGTASLSNMGMFG
IKQFEAVINPPQGMIMAIGAGDKRPYVVDDSLQIATVMSATGSFDHRAIDGADGARLMKA
FKELIENPIGMLA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagacgatccagatgcccgctttgtccccgaccatggaggaagggactctggcc
aaatggctggtaaaggaaggggatacggtatcgtccggcgatctgctggcggaaatcgaa
accgacaaggcgacgatggaatttgaagcggtggatgaaggcgtcatcgccaagatcctc
gtttccgaaggttccgaaggcgtcaaggttggcaccgtcatcgccattatcgctgaagag
ggcgaggatgtggaggcggcggctgccggcggcggcaagcccgcgccaaaggccgatcct
gtccccgccaaggcagaggctgcggcacccgccgctgccgcgccgaaggctgacgccgtg
cccgctgcgccagcctccagcgacaagcgcgtcaaggccagcccgctggcgcgccgcctg
gcgcagagcaaggggatcgatctggctgtggtttcggggactggcaccaatggccgtatc
gtcaagagcgatctggacggcgcaaaggaaggcgtcgccgcaccggctgccgcgcccgcg
tcggctcccgccgccaaggcagaggcggcagccccggcgcccgccgctgccagcggcgcg
caggatttcggcatcccgcacgaagtggtcaaactcagcggcatgcgcaagacgatcgcg
cgccgcctgaccgagtccaagcagcaggtgccgcacatctatctgaccgtcgacattcag
ctcgacaagctgctcaagctgcgcagcgagctcaatgcgggcctggccagccgcaaggtc
aagctgtccgtcaacgacctgctgatcaaggcgctgggcgtcgcgctgatggaagttccc
gaatgcaacgtgcagtttgcgggcgaccagatgctgcaattcaagcgcgccgacatcagc
gtcgccgtgtctatccccggcggtctcatcaccccgatcgtgaccggcgcggatggcaag
ggcgttgccgcgatctcgaccgagatgaaggatctggccgatcgcgccaaggcaggcaaa
ttgtcgcccaacgaatatcagggcggcactgcatcgctctccaacatgggcatgttcggc
atcaagcagtttgaagccgtcatcaacccgccccagggcatgatcatggcgatcggcgca
ggcgataagcggccctatgttgtcgacgacagccttcagattgcgacggtcatgtcggcc
accggcagtttcgaccatcgtgccattgacggcgccgatggggcgcgcctgatgaaggcg
ttcaaggaactgatcgagaatccgatcggcatgctggcctga

DBGET integrated database retrieval system