KEGG   Sphingobium hydrophobicum: CJD35_17570Help
Entry
CJD35_17570       CDS       T05146                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
shyd  Sphingobium hydrophobicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASY46280
UniProt: A0A249MY29
LinkDB All DBs
Position
II:601992..603461
Genome map
AA seq 489 aa AA seqDB search
MVPDNIHIAHPDKLFIGGAWVESTADRMIEIVSPNSEAVIARVVDGTEADMDRAVAAART
AFDDGPWSTMAPAERGAIVRRMGEELGKRAPELSAAWTAQVGGLASFAPIMTGGATATFM
AIAGYADSFPFVEKRPASQVHTAIVAQEPAGVVAAIAPWNAPYGIMSSKVAYAMVAGCTV
IMKPSPETPLEAYIIAEAAEAAGVPAGVVNLVAAGRDASDHLVRNPGIDKVTFTGSTLAG
KRIGEVCAGRVARCTLELGGKSAAIVRDDFPIEVAAAILGNTITIMSGQVCAMLSRAIVP
RHRHDELADAIAKVMQGIRIGHSDAPDTQLGPVAMKRQLERVEEYVALGRASADLVTGGN
RPAHMNSGYFIEPTLFANVDNKSRIAQEEIFGPVLCLIPADDEEDAIRIANDSAFGLNGS
VLTNDADAAYRIGRRIRAGGFGQNGMKMEFGLPFGGFKQSGIGREGGVEGLHAYLETKTM
LLDATPSGF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggttcccgacaacatccatatcgcccaccccgacaagctgttcattggtggcgcatgg
gtcgaatcgacggctgaccggatgatcgaaatcgtttcgcccaacagcgaggcggttatt
gcccgcgtcgtcgatgggaccgaagcggacatggaccgcgccgtcgctgccgcccgcacg
gcgttcgatgatggcccatggtccaccatggcgcctgccgagcgtggcgcgatcgtgcgg
cggatgggtgaagaattgggcaagcgcgcgcctgaactgtccgccgcctggacggcgcag
gtcggtggcctcgccagctttgcgccaatcatgactggcggtgcgaccgcaacattcatg
gcgatcgcaggctatgccgacagctttccctttgtcgaaaaacgtccggcgagccaggtc
catacggcgatagttgcgcaggaacccgctggcgttgtcgccgcgatcgcgccctggaac
gcgccctatggcatcatgtcgtccaaggtcgcctatgccatggttgcaggctgcaccgtc
atcatgaagccgtcgccggagaccccgctggaagcctatatcatagccgaagcggcggaa
gcggcaggggtgccggccggcgtggtcaatctggtcgcggcgggacgcgacgcatccgac
catctggtccgcaaccccggcatcgacaaggtgaccttcaccggatcgacgctggcgggc
aagcggatcggcgaggtctgcgccgggcgggtcgcgcgttgcacgctggaactgggcggc
aaatcggcagcgatcgtgcgcgacgattttcccatagaggtcgccgctgcgatcctgggc
aacaccatcacgatcatgagcggacaggtttgcgccatgctgtcgcgtgcgatcgtgccg
cgccatcgtcatgacgaactggccgacgccattgcaaaggtgatgcagggcatccgcatc
ggccatagcgatgcgcccgatacacagcttggcccggtggcgatgaagcgccagcttgaa
cgggtggaggaatatgtcgcgctgggtcgcgcaagtgccgatctcgtgaccggcggcaac
cggcctgcccatatgaacagcggctatttcattgaacccaccctgttcgcgaatgtggat
aacaagagccgcatcgcgcaggaggaaattttcggccccgtgctgtgcctcattcccgcc
gatgatgaggaggatgcaatccgcatcgccaatgacagcgcctttggcctgaatggatcg
gtgctgaccaatgacgccgatgccgcctatcgcatcggccgtcgcatccgcgcaggcgga
tttgggcagaatggcatgaagatggagttcggcctgccttttggcggcttcaagcaatcg
gggatcgggcgcgagggcggggtggaaggcctgcacgcctatctggaaaccaagaccatg
ttgctcgacgccacgcccagcggcttttga

DBGET integrated database retrieval system