KEGG   Shinella sp. HZN7: shn_07405Help
Entry
shn_07405         CDS       T04278                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
shz  Shinella sp. HZN7
Brite
KEGG Orthology (KO) [BR:shz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:shz03012]
    shn_07405
   03029 Mitochondrial biogenesis [BR:shz03029]
    shn_07405
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shz04147]
    shn_07405
Translation factors [BR:shz03012]
 Eukaryotic Type
  Elongation factors
   shn_07405
 Prokaryotic Type
   shn_07405
Mitochondrial biogenesis [BR:shz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    shn_07405
Exosome [BR:shz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   shn_07405
  Exosomal proteins of breast cancer cells
   shn_07405
  Exosomal proteins of colorectal cancer cells
   shn_07405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ANH03884
UniProt: A0A1A9FYZ8
LinkDB All DBs
Position
1535301..1536476
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMAAVDSYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVNRDGVERGQILCKPGSVKPHK
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaagtttgagcgcactaagcctcacgtaaacatcggcacgatcggccac
gttgaccatggcaagacgtcgctgacggcagcgatcacgaagtatttcggcgagttcaag
gcgtatgaccagatcgacgccgccccggaagaaaaggcccgcggcatcaccatctcgacg
gcgcacgtcgagtacgagacgccgaaccgtcactatgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtc
tgctctgccgctgacggcccgatgccgcagacccgcgagcacatcctgctcgcccgccag
gtcggcgttcccgccatcgtcgtgttcctcaacaaggtcgaccaggtcgacgacgccgag
ctgctcgagctcgtcgagctggaagtgcgcgaacttctgtcgtcctacgacttcccgggc
gacgacattccgatcatcaagggctcggctctggccgcgctcgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggccgccgtcgacagctacatcccgacgccg
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggcacggtcgtcacgggccgcgtcgagcgcggtatcgtcaaggtcggtgaggaaatc
gagatcgtcggcatccgcccgacgacgaagacgacctgcacgggcgtcgagatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggtgcgctgctgcgcggtgtgaac
cgtgacggcgtcgagcgtggccagatcctgtgcaagccgggttcggtcaagccgcacaag
aagttcaaggccgaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcacgaactaccgtccgcagttctacttccgcacgacggacgtgacgggcatcgtgacg
ctgccggaaggcacggaaatggtgatgccgggcgacaacgtgacggttgatgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgcgatccgcgaaggcggccgcacc
gtcggcgccggcatcgtcgcctcgatcgtcgagtaa

DBGET integrated database retrieval system