KEGG   Shinella sp. HZN7: shn_08380Help
Entry
shn_08380         CDS       T04278                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
shz  Shinella sp. HZN7
Pathway
shz00340  Histidine metabolism
shz01100  Metabolic pathways
shz01110  Biosynthesis of secondary metabolites
shz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    shn_08380
Enzymes [BR:shz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     shn_08380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: ANH04050
UniProt: A0A1A9G0T6
LinkDB All DBs
Position
complement(1725419..1725871)
Genome map
AA seq 150 aa AA seqDB search
MPMTFKTPPKDKAELETGPAFTPRFDEHGLVTAVVTDAKDGELLMVAHMNAESLALTIET
GIAHYWSRSRKALWKKGETSGNLQTVVELRTDCDQDAVWLKVSVAGHDATCHTGRRSCFY
RTVSNGPDGAVLTITGGAPQFDPAAIYGKN
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgaccttcaagaccccgcccaaggacaaggccgagctcgaaacgggcccggcc
ttcacgccgcgcttcgacgagcacggcctggtgacggccgtggtgacggatgcgaaggac
ggcgaactgcttatggtcgcccacatgaatgccgaatcgctggcgctgaccatcgagacc
ggcatcgcgcattactggagccgctcgcgcaaggcgctgtggaagaagggcgaaacgtcg
ggcaacctgcagaccgtcgtggaattgcggacggattgcgaccaggatgccgtctggctg
aaggtctcggtcgccggccatgacgcgacctgccacaccggccgccgctcctgcttctac
cgcacggtctcgaacggtcccgacggcgccgtgctgaccatcacgggcggcgcgccgcag
ttcgacccggcggcgatctacggcaaaaattaa

DBGET integrated database retrieval system