KEGG   Shinella sp. HZN7: shn_09335Help
Entry
shn_09335         CDS       T04278                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
shz  Shinella sp. HZN7
Pathway
shz00061  Fatty acid biosynthesis
shz00780  Biotin metabolism
shz01100  Metabolic pathways
shz01212  Fatty acid metabolism
Module
shz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:shz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    shn_09335
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    shn_09335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:shz01004]
    shn_09335
Enzymes [BR:shz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     shn_09335
Lipid biosynthesis proteins [BR:shz01004]
 Fatty acid synthase
  Component type
   shn_09335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ANH04219
UniProt: A0A1A9G1Q3
LinkDB All DBs
Position
complement(1922909..1923376)
Genome map
AA seq 155 aa AA seqDB search
MSEETKATLGVADLREILTLLPHRYPFLLVDKIIDIDGDDSAVGIKNVTVNEPQFMGHFP
DHPIMPGVLLIEGMAQTAGAICARKTRSGSNLVYFMTIDNARFRKPVVPGDRVEFHVVKQ
KQRGNIWKFHCDAKVDGQLVAEADIGAMIVKKEDA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagagaccaaggcgacgctcggcgtggctgatctgcgtgaaatcctgacgctg
cttcctcatcgctatccattcctgctcgtcgacaagatcatcgacatcgacggcgacgat
tcggctgtcggcatcaagaacgtcacggtcaacgagccgcagttcatgggccatttcccc
gaccacccgatcatgccgggcgtgctgctcatcgagggcatggcgcagacggccggcgcg
atctgcgcccgcaagacgcgctcgggctccaacctcgtctacttcatgacgatcgacaat
gcccgcttccgcaagccggtcgtgcccggtgaccgcgtcgagttccatgtcgtcaagcag
aagcagcgcggcaatatctggaagtttcactgcgatgcaaaagttgatgggcaactcgtc
gcggaagctgatatcggcgcgatgatcgtcaagaaggaagacgcctga

DBGET integrated database retrieval system