KEGG   Shinella sp. HZN7: shn_11445Help
Entry
shn_11445         CDS       T04278                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shz  Shinella sp. HZN7
Pathway
shz00473  D-Alanine metabolism
shz00550  Peptidoglycan biosynthesis
shz01100  Metabolic pathways
shz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    shn_11445
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    shn_11445
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    shn_11445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shz01011]
    shn_11445
Enzymes [BR:shz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     shn_11445
Peptidoglycan biosynthesis and degradation proteins [BR:shz01011]
 Precursor biosynthesis
  Amino acid ligase
   shn_11445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ANH04589
UniProt: A0A1A9G2T4
LinkDB All DBs
Position
complement(2382500..2383426)
Genome map
AA seq 308 aa AA seqDB search
MSVKHVAMLMGGFSSERPVSLSSGNACADALEAEGYKVTRVDVGHDVASVLAELKPDVAF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKAQAKIIAKSAGIPIAEQRLMDR
FDFTSAHPMKPPYVVKPVREGSSFGVVMVKEDQSHPPQIITSPEWRYGDSVMVERYIYGR
ELTCGVMGDVALGVTEVVPQGHAFYDYDSKYVKGGSKHVIPAQISPNIYQKVQTLSLKAH
QAIGCRGVSRSDFRYDDRFSENGELIWLEINTQPGMTPTSLVPEMAVHAGHSFGEFLRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgaagcatgtcgcgatgctgatgggtggtttttcgtcggaacggccggtgagc
ctttcgtcgggcaacgcctgcgccgacgcgcttgaggccgagggctacaaggtcacccgc
gtcgatgtcggccacgacgtcgccagcgtgcttgccgaactgaagccggatgtcgccttc
aacgcgctgcacgggcccttcggcgaggacggcaccatccagggcatcctcgaatatctc
gaaatcccctatacccattccggcgtgctcgcttccgctcttgcaatggacaaggcgcag
gcgaagatcatcgccaagtctgccggcattccgatcgccgagcagcggctgatggatcga
ttcgatttcacctcggcgcatccgatgaagccgccatacgtggtcaagccggtgcgcgaa
ggctcctccttcggcgtcgtcatggtcaaggaagaccagtcgcatcccccgcagatcatc
acgtccccggaatggcgctatggcgacagcgtcatggtcgagcgctacatctacggccgg
gaactgacctgcggcgtcatgggcgacgtcgcgctcggcgtcaccgaagtggtgccgcag
ggccacgccttctacgactatgattccaaatatgtgaaaggcggctcgaaacacgtcatc
ccggcgcaaatttcaccgaatatttaccaaaaagtacaaacactctccctcaaggcgcat
caagcgatcgggtgccgtggcgtcagccgttccgacttccgttacgacgaccgattctcc
gagaatggcgagcttatctggctggagatcaacacccagcccggcatgaccccgacctcc
ctggtgcccgaaatggccgtccatgccggccattcctttggtgaattcttgcggtggatg
gtggaggacgcgtcgtgtttgcgttga

DBGET integrated database retrieval system