KEGG   Shinella sp. HZN7: shn_13220Help
Entry
shn_13220         CDS       T04278                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
shz  Shinella sp. HZN7
Pathway
shz00240  Pyrimidine metabolism
shz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    shn_13220
Enzymes [BR:shz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     shn_13220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_14 AAA_22 AAA_19 FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ANH04901
UniProt: A0A1A9G3A8
LinkDB All DBs
Position
complement(2747637..2748224)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFSYATMNAGKSTLLLQASYNYRERGMRTAILIASFDDRAGQGRISSRIGLTSEAI
AFDHADDLYKHVEELNGDGSGEIACVFVDEAQFLSEEQVWQLARVADRLHIPVMAYGLRT
DFQGKLFPGSKALLAIADELREVRTICHCGRKATMVVRLGADGKVAREGAQVEIGGNDKY
VSYCRRHWDDIMNAD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcagttacgcgacgatgaacgcgggcaagtcgacgctgctcctg
caggcgtcctacaactaccgcgaacgcggcatgcgcacggcgatcctgatcgcctccttc
gacgaccgcgccggccagggccgcatctcctcgcgtatcggcctgacctcggaagccatc
gccttcgaccatgccgacgacctctacaagcatgtcgaggaactgaatggcgacggcagc
ggcgagatcgcctgcgtcttcgtcgatgaggcgcagttcctctccgaggagcaggtctgg
cagctcgcccgcgtcgccgaccggctgcacatccccgtcatggcctacggcctgcgcacc
gatttccagggcaagctctttcccggctcgaaagcgctgctcgccatcgccgacgagctg
cgcgaggtgcgcaccatctgccattgcggccgcaaggcgacgatggtcgtccggctcggg
gcggacggcaaggtggcgcgggaaggcgcgcaggtggaaatcggcggcaatgacaagtac
gtttcctattgccgccgccattgggacgacatcatgaacgccgattga

DBGET integrated database retrieval system