KEGG   Shinella sp. HZN7: shn_19035Help
Entry
shn_19035         CDS       T04278                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
shz  Shinella sp. HZN7
Pathway
shz00564  Glycerophospholipid metabolism
shz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    shn_19035
Enzymes [BR:shz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     shn_19035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_3 FAD_oxidored NAD_binding_8 FAD_binding_2 3HCDH_N GIDA Mqo Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANH05924
UniProt: A0A1A9G4V4
LinkDB All DBs
Position
complement(3939657..3941174)
Genome map
AA seq 505 aa AA seqDB search
MNGDVIRDIFVIGGGINGCGIARDAAGRGYSVVLAEMKDFASGTSSASTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPFQKGGLRPAWLIRLGLFLYDYIGGRKL
LPATRTLDLAKDPAGGPLKKLFRKAFEYSDGWVDDARLVVLNARDAADRGADIRTGTKVV
TARRENGHWTVETENVETGARENVRARMLVNAAGPWIDKVLSTAFGRNDVHNVRLVQGSH
IVVKRKFSDPRAYFFQNPDGRIMFAIPYQEEFTLIGTTDQDYQGDPRDVRISDAEIDYLC
ASASEYFAEPVTRNDIVWTYSGVRPLFDDGASKAQEATRDYVLKVEGGDGQAPLLNIFGG
KLTTYRRLAESALEKIEDAIGAKGDRWTAGSRLPGGDFKVDGFDVEVKALSARFAFLAPA
HARRLVRLYGTRAAAMLDGAKGIDDLGRHFGSDLYEREVRWLMKEEWARHAEDVLWRRTK
RGLHLTAAEAAALEDYMAAAQAAPH
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggcgacgtgatccgcgatattttcgttatcggtggcggcatcaacggctgcggc
atcgcgcgcgatgcggcgggccgtggttattcggtcgtgcttgccgagatgaaggacttt
gcgtcgggcacgtcctcggcctccaccaagctcatccatggtggcctgcgttacctcgaa
cattacgaattccgcctggtgcgcgaggcgttgatggagcgcgaagtgctctgggccatg
gcgccgcacgtcatctggccgatgcgcttcgtgctgcccttccagaagggcggcctgcgc
ccggcctggctcatccgcctcggcctgttcctgtatgactatatcggcgggcgcaagctg
ttgccggccacccgcacgctcgaccttgcaaaggacccggccggcgggccgctgaagaag
ctcttccgcaaggccttcgaatattccgacggctgggtggacgatgcgcgcctcgtcgtc
ctgaatgcccgtgacgccgccgatcgcggcgcggatatccgcaccggtaccaaggtcgtc
accgcgcgccgcgaaaacggccactggaccgtcgagaccgagaatgtcgagacgggcgcg
cgtgaaaacgttcgtgcgcgcatgctggtcaatgcggcaggcccctggattgacaaggtc
ctctcaaccgccttcggccgaaacgacgtgcacaatgtccgcctcgtgcagggcagtcac
atcgtcgtgaagaggaagttctccgatccgcgcgcatacttcttccagaacccggacggg
cgtatcatgttcgccattccctaccaggaagaattcacgctgatcggcacgaccgaccag
gactatcagggcgatccccgggatgttcgcatcagcgacgcggaaatcgattatctttgc
gcctcggcgagcgaatatttcgccgaacccgtgacgcggaacgacatcgtctggacctat
tccggcgtgcgcccgctcttcgacgacggcgccagcaaggcgcaggaagcgacgcgcgac
tacgtgctgaaggtcgagggcggcgatggccaggcaccgctgctcaacatcttcggcggc
aagctcaccacctaccggcgcctcgccgaatcggcgctggagaagatcgaggatgcgatc
ggcgcgaagggagatcgctggacggccggctcacgcctgcccggcggcgatttcaaggtc
gacgggttcgatgtcgaggtgaaggcgctttccgcgcggttcgccttcctcgccccggcc
catgcccgccggctcgttcggctctacggcacgcgggcggcagcgatgctggacggtgcg
aagggcatcgacgatctcggccggcatttcggcagcgacctctatgagcgtgaagtgcgc
tggctgatgaaggaggaatgggcccggcatgccgaggacgtgctgtggcggcggaccaaa
cgcggattgcatctgacggccgcggaggcggccgcactggaagactacatggcggccgca
caggcggctccccactag

DBGET integrated database retrieval system