KEGG   Shinella sp. HZN7: shn_24860
Entry
shn_24860         CDS       T04278                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
shz  Shinella sp. HZN7
Pathway
shz00010  Glycolysis / Gluconeogenesis
shz00030  Pentose phosphate pathway
shz00051  Fructose and mannose metabolism
shz00680  Methane metabolism
shz01100  Metabolic pathways
shz01110  Biosynthesis of secondary metabolites
shz01120  Microbial metabolism in diverse environments
shz01200  Carbon metabolism
shz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    shn_24860
   00030 Pentose phosphate pathway
    shn_24860
   00051 Fructose and mannose metabolism
    shn_24860
  09102 Energy metabolism
   00680 Methane metabolism
    shn_24860
Enzymes [BR:shz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     shn_24860
SSDB
Motif
Pfam: F_bP_aldolase OST_P2
Other DBs
NCBI-ProteinID: ANH07346
UniProt: A0A1A9G8E1
LinkDB
Position
pShin-01:535418..536461
AA seq 347 aa
MALITMRQLLDHAAENDYALPAFNVNNLEYIQAVMRAADATDSPVILQASRGARAYAGDA
FLRHLILGAAEEYPHIPVCLHLDHGDQPSTCISAITNGFTSVMMDGSLLADGKTVASYEY
NVDVTAEVVKIAHAAGVSVEGELGCLGNLETGAGDKEDGHGFEGKLSREELLTDPDQALD
FVSRTGVDALAVAIGTSHGAYKFTRAPDGDILSIDTIAKINEKLPNTHLVMHGSSSVPQD
LQDLFTAYGGEMKQTWGVPVAEIQKAIPLGVRKVNIDTDLRLAMTGTIRKNFKEKPDNFD
PRNYLKPATALMADVCKERFEAFRTAGKASSIRVKRLPDMAKFYATK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcattgatcaccatgcggcaattgctcgatcacgcagcggagaatgactacgcactg
cccgcattcaacgtcaacaacctggaatatatccaggcggtcatgcgcgcggcggatgcg
acggattctccggtgatcctgcaggcgagccgcggtgcgcgcgcctatgcgggcgatgct
ttcctgcgccacctgatcctcggtgcggcagaggaatatccgcatatcccggtctgcctt
cacctcgaccacggcgaccagccctccacctgcatctcggccatcaccaacggcttcacc
tccgtcatgatggatggttcgctgctcgccgatggcaagaccgtcgccagctacgaatac
aatgtcgatgtgacggcggaggtcgtgaagattgcgcacgcggccggcgtttcggtcgaa
ggtgagcttggctgtctcggcaacctggaaacgggcgccggcgacaaggaggacggccat
ggcttcgagggcaagctttcccgcgaggaactgctgaccgatccggaccaggcgctcgac
ttcgtctccaggaccggcgtcgacgcgctggccgtcgccatcggcaccagccacggcgcc
tacaagttcacccgcgcgccggacggcgacatcctgtcgatcgatacgatcgcgaagatc
aacgagaagctgccgaacacgcatctcgtcatgcacggctcctcctcggttccgcaggac
ctgcaggatctcttcaccgcctatggcggcgagatgaagcagacctggggcgtgccggtc
gccgaaatccagaaggcgatcccgctcggtgtgcgcaaggtcaatatcgacacggacctg
cgccttgccatgaccggcacgatccgcaagaacttcaaggaaaagccggacaatttcgac
ccgcgcaactacctgaagccggcgaccgccctgatggcggacgtctgcaaggagcgcttc
gaagccttccgcaccgccggcaaggcctccagcatccgcgtgaagcgcctgcccgacatg
gcgaagttctacgcgaccaagtaa

DBGET integrated database retrieval system