KEGG   Shinella sp. HZN7: shn_31130Help
Entry
shn_31130         CDS       T04278                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
shz  Shinella sp. HZN7
Pathway
shz03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:shz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    shn_31130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:shz03400]
    shn_31130
Enzymes [BR:shz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     shn_31130
DNA repair and recombination proteins [BR:shz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     shn_31130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ANH08598
UniProt: A0A1A9GDH8
LinkDB All DBs
Position
pShin-06:complement(39648..42284)
Genome map
AA seq 878 aa AA seqDB search
MADKLSTYKKKRDFKQTQEPSGSTAVKSSNRLRFIIQKHDATRLHYDLRLEFDGVFKSWA
VTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTISKGQYGGGTVMLWDRGYWEPEGNKSPEE
ALKKGDFKFVLHGKRLHGSFVLVRMRNDRDGGKRTNWLLIKHHDEHAVEENGAAILDENM
TSVASGRKMEQIAGGKGRKPKPFMTASGDVEADAVWDTKHGLAADERKKKTRKDVATSTS
ADLPDFIPPQLCETLERPPAGDKWLHEIKFDGYRIQMRAANGDVTLKTRKGLDWTAKYPE
IAEAAASLPDCIIDGEICALDDNGAPDFAALQAALSERNTGNLVYFAFDLLFDGGEDLRD
KPLVDRKARLQELLTDATEDPHLRFVEHFETGGDAVLRSACKLSLEGIVSKQEDASYRSG
RTDTWAKSKCRAGHEVVIGGYAKTNGKFRSLLVGVNRGEHFVYVGRVGTGYGAKKVETLL
PKLKAAETEKSPFTGIGAPKKEREVVWLKPELVAEIEFAGWTADGLVRQAAFKGLREDKP
AAEVEADKPASPAKTETPEPAVAAKVKPARRKGAKAEVMGVLISNPDKPLWPDAGDGKPV
TKEELAHYHEAVGAWLIEHVKGRPCSIIRAPDGIGGEQFFQRHAMPGTSNLLELVKVFGD
KKPYLQVDRVEGLVAIAQIGGIELHPWNCEPGKPEVPGRLVFDLDPGPDVPFSAVVAAAR
EMRDRLDDLGLISFCKTTGGKGLHVVTPLAVNARKPLSWAEAKGFAHDVCQEMARDNPDL
YLIKMTKSLREGRIFLDYLRNDRMATAAAPLSPRARPGATVSMPLTWTQVKSDLDPKRFT
IRTVPGLLAKTSAWEDYCDGQRRLEQAIKRLGKHKAAA
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaagctatcgacatacaagaagaagcgggatttcaagcagacgcaggagccg
agtggctcgacggccgtcaaatcctcgaaccggctgcgctttatcatccagaaacacgat
gccacgcgcctgcattacgatcttcgcctcgagttcgacggcgttttcaaatcctgggcg
gtgaccaagggaccatcgctcgatccccatgacaagcggctggcggtcgaggtcgaggat
cacccgctcgactatggcgacttcgaaggaacgatctcgaagggccaatatggtggcggc
acggtgatgctgtgggatcgcggctactgggagcctgaaggcaacaagtcccccgaagag
gctttgaagaagggtgacttcaagttcgtgctccatggcaagcgtctgcatggcagcttc
gtgctcgtgaggatgcgcaacgatcgcgatggcggtaagcggacaaactggctgctgatc
aagcaccacgacgagcacgccgtcgaggagaacggcgccgccatcctggacgagaacatg
acctcggtcgcctccggccggaagatggagcagatcgccggcggcaaggggcggaagccg
aaaccgttcatgacggccagcggcgacgtcgaggccgatgctgtctgggacaccaagcat
ggcctcgcggctgacgagcgtaaaaagaagacgcgcaaggacgtcgcgacatcgacgtca
gccgatctgcctgactttattcccccgcagctctgcgaaacgctcgaacgcccgcccgcc
ggcgacaagtggctgcatgagatcaagttcgacggctatcgaattcagatgcgggccgcg
aatggcgatgtgacgctcaaaacccgcaagggcttggattggaccgccaagtatccggag
atcgccgaggccgccgcatcacttccggattgcatcatcgacggcgagatctgcgcgctc
gacgataacggcgccccggacttcgcggccttgcaggcggcgctctcggagcgcaacacg
ggcaacctggtctatttcgcattcgaccttctgttcgatggaggggaagaccttcgcgat
aagcctttggtcgaccggaaagctcggctgcaggagctgcttactgatgcaaccgaggat
ccgcacttgcgctttgtcgagcatttcgagacgggcggcgacgcggttcttcgctccgcc
tgcaagctctcgctcgaaggcatcgtctcgaaacaggaggatgcgtcgtatcgttcgggt
cgtaccgacacttgggcgaaatcgaaatgccgcgcagggcacgaagtcgtcatcggcggt
tatgccaagacgaacggcaaattccgctcgctgctggtcggcgtcaatcgcggcgagcat
ttcgtctatgtcggccgcgtcggtacgggctatggcgccaagaaggtcgaaacgctcctg
cccaagctcaaagccgctgagacggagaaatcccctttcacggggataggcgcgccgaag
aaggagagggaggtcgtctggctcaaacccgagttggtcgccgagatcgaattcgccggc
tggaccgcggacggtttggttcgccaggccgcgttcaagggcctgcgggaggataagccg
gccgccgaggtcgaagccgataagcccgcctcgccggcaaagaccgagacaccagagccg
gccgtggccgcaaaggtgaagcccgcgcgccggaagggtgcaaaggcggaggtcatgggc
gtgctcatctccaatccggacaaacccttgtggccggacgcgggcgacggcaagcccgtg
accaaagaggagctggcccactatcacgaagctgtcggcgcctggctcatcgagcatgtg
aagggtcggccgtgttcgatcatccgcgcgccggatggcattggcggcgagcaattcttc
cagcggcacgccatgccgggcacttcgaacctgctggaactggtcaaggtctttggtgac
aagaagccctacctgcaggtcgatcgtgtcgaaggcctcgtcgccatcgcccagatcggc
ggcattgagttgcatccgtggaactgcgaaccggggaaacccgaagtgccgggtcggctg
gtattcgacctcgatcccggcccggacgtgccattctccgccgtggtcgccgccgcgcgc
gagatgcgcgaccgcctggacgatctcggccttatcagtttctgcaagaccacgggtggc
aaggggctgcatgttgtgacgccgcttgccgtcaatgcccgcaagccgctctcctgggcc
gaggccaagggcttcgcccacgatgtctgccaggagatggcgcgcgacaaccccgacctc
tatctcatcaagatgaccaagagcctgcgggaaggccgcatcttcctagactatctgcgc
aacgaccgaatggcgacggcggcggcacccctctcgccgcgagcgcggcccggcgccacc
gtgtcgatgccgctgacgtggacgcaggtcaaatccgacctcgatccgaagcggttcaca
atccgcactgtgccggggctgctggcgaagacgagtgcctgggaggattactgcgatggc
cagcgccggctggaacaggcgatcaagcgcctcggcaagcacaaggcggccgcatga

DBGET integrated database retrieval system