KEGG   Sulfolobus islandicus M.14.25: M1425_1980Help
Entry
M1425_1980        CDS       T00890                                 

Definition
(GenBank) lysine biosynthesis enzyme LysX
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00300  Lysine biosynthesis
sia01100  Metabolic pathways
sia01210  2-Oxocarboxylic acid metabolism
sia01230  Biosynthesis of amino acids
Module
sia_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:sia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    M1425_1980
Enzymes [BR:sia01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     M1425_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK GSH-S_ATP ATP-grasp_3 ATPgrasp_ST CPSase_L_D2 Dala_Dala_lig_C ATP-grasp_5 Ins134_P3_kin ATP-grasp GARS_A ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: ACP38722
UniProt: C3MYT8
LinkDB All DBs
Position
complement(1815483..1816334)
Genome map
AA seq 283 aa AA seqDB search
MKIGILYDMPRWEEKNLIEEGKKLGYQVTTIYSKDFVLFSNEFNIENDVNLFIQRNISHN
RALITSFLVEQLGYPVINDHMTLIRCENKIFTTYILAKHNIPTPKTFIAFDKTNAMEYSK
KLGYPVVIKPVEGSWGRMVAKADNLDVLYSYLEYQEFSTQKYKDIYYIQEFVNKPNRDIR
IFVIGDETPVGIYRFNENNWRTNTALGAKAYPLKIDEELKELALKVKDIIGGFFLGIDIF
EDKDRGYLVDEVNGVPEYKNTVRVNNFNISKFLLEKAVEWVKK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataggaattctatatgatatgcctagatgggaggaaaaaaacctaattgaagag
ggaaaaaaattaggctatcaagttactaccatatatagtaaagattttgttcttttttca
aatgagtttaatatagagaatgatgtaaatctttttatccaaagaaacatatcacataac
agagcacttattacatcgtttctagtagagcagcttggctatcccgtaataaatgaccat
atgactctaattagatgtgaaaacaaaatttttacaacatatattttagccaaacataat
ataccaactcctaaaactttcatagcatttgataaaactaacgcaatggaatattcaaaa
aaactaggatatccagtagttataaaaccggttgaaggaagctgggggagaatggtagct
aaagctgataatctagacgtactatatagttatttagagtatcaagaatttagtacacaa
aaatacaaagatatatattacatacaagaatttgttaacaagccaaatagggatataaga
atatttgtgataggagacgaaactccggttggaatttacagatttaatgaaaataattgg
agaactaatactgcattaggtgcaaaagcatatcctcttaaaatagatgaggaactcaaa
gagttggcattgaaagtaaaggacataatagggggtttctttttaggaatagatatattt
gaggataaggatcggggatatctcgtagatgaagtaaatggagtaccagaatataaaaat
actgtaagagtaaataattttaatatatcaaaattccttttggaaaaagcagtagagtgg
gtgaaaaaatga

DBGET integrated database retrieval system