KEGG   Sulfolobus islandicus M.14.25: M1425_2246Help
Entry
M1425_2246        CDS       T00890                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K19588  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00040  Pentose and glucuronate interconversions
sia00053  Ascorbate and aldarate metabolism
Brite
KEGG Orthology (KO) [BR:sia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M1425_2246
   00053 Ascorbate and aldarate metabolism
    M1425_2246
Enzymes [BR:sia01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     M1425_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1794
Motif
Other DBs
NCBI-ProteinID: ACP38979
UniProt: C3MS36
LinkDB All DBs
Position
2056772..2058208
Genome map
AA seq 478 aa AA seqDB search
MKSYQGLADKWIKGSGEEYLDINPADKDHVLAKIKLYTKDDVKEAINKAVAKFDEWSRTP
APKRGSILLKAGELMEQEAQEFALLMTLEEGKTLKDSMFEVTRSYNLLKFYGALAFKIAG
KTLPSADPNTRIFTVKEPLGVVALITPWNFPLSIPVWKLAPALAAGNTAVIKPATKTPLM
VAKLVEVLSKAGLPEGVVNLVVGKGSEVGDIIVSDDNIAAVSFTGSTEVGKRIYKLVGNK
NRMTRIQLELGGKNALYVDKSADLTLAAELAVRGGFGLTGQSCTATSRLIINKDVYTQFK
QRLLERVKKWRVGPGTEDVDMGPVVDEGQFKKDLEYIEYGKNAGAKLIYGGNTVPGKGYF
LEPTIFEGVTSDMRLFKEEIFGPVLSVTEAKDLDEAIRLVNAVDYGHTAGIVASDIKAIN
EFVSRVEAGVIKVNKPTVGLELQAPFGGFKNSGATTWKEMGEDALEFYLKEKTVYEGW
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgtatcagggattggctgacaagtggattaagggcagtggggaagaatacctt
gatattaatccagctgataaggatcacgtattagctaagataaaattatatacaaaagat
gacgttaaagaagctataaacaaggctgtagccaaattcgacgaatggtcaaggactcca
gcacctaaaagaggctcaatattacttaaggcaggggaattaatggaacaagaagcccaa
gagtttgcgctattgatgacattagaggagggtaagactctcaaggatagtatgtttgaa
gtgacaagaagttataatttactgaaattttatggtgcattagcatttaagatagctggg
aaaacgcttccttcagcagatcctaatactaggatatttacagtaaaggaacccttaggc
gtagtagctttaattacgccgtggaatttcccattatcaataccagtatggaaattggct
ccagccttggctgcgggtaacactgcagtaataaaaccagcgacgaaaacgccgttaatg
gtagccaaattggtagaagtattgtctaaagctggattgccagagggtgtcgtgaattta
gtagttggtaagggaagtgaagtcggagatatcatagtaagtgatgataatatagctgca
gtatcatttactggatcaaccgaggtaggtaagagaatttacaaactcgtaggaaataaa
aatagaatgacaagaattcaactagagctaggaggtaaaaacgcgttatatgtggataag
agcgctgacttaacgttagctgctgaattagccgtaagaggaggatttggactaaccggt
caatcatgtactgcaaccagtaggttaataattaacaaggatgtatatactcaatttaaa
caaagactactagaaagagttaagaagtggagagtaggaccgggtactgaagatgttgat
atgggtccagttgtagatgaaggtcaatttaagaaagacttagaatatatagaatacgga
aagaatgccggagcaaaactaatttatggtggaaatacagtaccggggaagggatatttc
ctagaacctacaattttcgaaggagtcacatctgatatgaggctatttaaagaagagatt
ttcggtccagtacttagtgtcactgaggcaaaagatttagatgaggctataaggctagtt
aacgctgtagactatggacatacagctggaatagtcgcaagtgatatcaaggcgattaac
gagttcgttagtagggtagaggcaggagttataaaggttaataagccaacagtcggactg
gaattgcaagcgccatttggtggttttaagaattctggagccactacgtggaaagagatg
ggagaagatgctttagagttctaccttaaggagaagacagtatacgaaggctggtag

DBGET integrated database retrieval system