KEGG   Streptococcus intermedius B196: SIR_0235Help
Entry
SIR_0235          CDS       T02830                                 

Gene name
glpF
Definition
(GenBank) putative glycerol uptake facilitator protein
  KO
K02440  glycerol uptake facilitator protein
Organism
sib  Streptococcus intermedius B196
Brite
KEGG Orthology (KO) [BR:sib00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sib02000]
    SIR_0235 (glpF)
Transporters [BR:sib02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    SIR_0235 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AGU75624
UniProt: T1ZBK3
LinkDB All DBs
Position
221837..222688
Genome map
AA seq 283 aa AA seqDB search
MDVTWIVKYITEFLGTAILIILGNGAVANVELKGTKGHQSGWLVIAVGYGMGVMIPALMF
GNVSGNHINPAFTLGLAISGYFPWVQVVPYIIAQLLGAMFGQALVVASHRPYYLQTTNPN
AILGSFSTIVNTDDGSKQSHAASMINGFINEFIGSFVLFFAAMAMTKNYFGAEVIKYAAT
RGVDATQLQGKVAIGSHINAGLAVAHLALGFLVMALVTSLGGPTGPGLNPARDLGPRILH
FLLPKSVLGEHKGDSKWWYAWVPVVSPILAGIVAVALYKLIYG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcacatggattgtgaaatatattacagagttccttggaacggcaattctcatt
atcttggggaacggagcggttgccaatgtggaattaaagggaacgaaaggtcatcaaagt
ggctggttagtcatcgcagttggttacggtatgggagttatgattcctgcacttatgttt
ggaaatgtatcaggaaaccacatcaatcctgcttttacactgggacttgcgattagtggc
tatttcccttgggtgcaagtcgtaccttacattattgcacagttattaggagcaatgttc
ggtcaagcgctagtagtagcaagtcaccgcccttattacttacaaacaaccaatccaaat
gctattttgggttcgttctcaaccattgtgaatacagatgatggaagcaagcaatcacat
gctgcttctatgataaacggttttatcaatgaatttattggttcatttgttttgttcttt
gcagcgatggcaatgactaagaattattttggcgcagaagttatcaaatacgctgcaact
cgaggagttgatgcaacacaacttcaaggaaaagttgccattggatcccacatcaatgct
ggtcttgctgtagctcacttagcgcttggttttcttgtgatggcattagtaacatcactc
ggtggtcctacaggtccaggtctgaaccctgcacgtgacttaggtccacgtattcttcac
ttccttcttccgaaatcagttcttggtgaacataaaggagattcaaaatggtggtatgct
tgggtaccagtcgtatctccgattcttgccggtattgttgctgtggcactttacaagttg
atttatggataa

DBGET integrated database retrieval system