KEGG   Streptococcus intermedius B196: SIR_1030Help
Entry
SIR_1030          CDS       T02830                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sib  Streptococcus intermedius B196
Pathway
sib00620  Pyruvate metabolism
sib00680  Methane metabolism
sib01100  Metabolic pathways
sib01120  Microbial metabolism in diverse environments
sib01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sib00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SIR_1030 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SIR_1030 (ppc)
Enzymes [BR:sib01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SIR_1030 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGU76391
UniProt: T1ZFA3
LinkDB All DBs
Position
complement(1063598..1066297)
Genome map
AA seq 899 aa AA seqDB search
MSLQKLENYNNKEVIQEEVTILTDLLEEVTQNMLSPETFEKIIALKELAAVGNYEGLNEI
VQNLSNKEMSYISRYFSILPLLINISEDVDLAFEINYQNNVGQDYLGKLSTTIDLVAERE
NAAEILEHLNVVPVLTAHPTQVQRTTMLDLTNHIHVLLRKYRDVRMGLLNEEKWHNDLRR
YIEIIMRTDMIREKKLKVTNEITNVMEYYNSSLLQAVTNLTEEYKRLAKKHGISLKNPTP
ITMGMWIGGDRDGNPYVTSETLKKSALTQCEVIMNYYDAKIANLYREFSLSTGIVKVSEA
VQEMAYLSEDNSIYREKELYRRAFYYIQTKLKNTKTYFIDQTEVEPHYHNIEEFKHDLLA
IKQSLLENKGEAMISGEFTELLQAVEVFGFYLASIDMRQDSSVHEACVAELLASAGIVEH
YSELSEGEKCHVLLNELFYDPRILSATHAEKSDLLQKELQIFQTARELKDMLGDAVIKQT
IISHATSVSDLLELAVMHKEVGLIDKESARVQIVPLFETIEDLDNSYDTMKKYLSLPIAQ
KWIASNNNYQEIMLGYSDSNKDGGYLSSCWTLYKAQQRLTAIGDEFGVKITFFHGRGGTV
GRGGGPTYEAITSQPLRSINDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSATINRMITK
KKSDTNTSNHYESIMDQVVDRSYQIYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAA
RKTITEIGGLRAIPWVFSWSQSRVMFPGWYGVGSSFKEFIDENPKENLAFLRKMYKNWPF
FRSLLSNVDMVLSKSNMNIAFEYAKLCEDEKVQEIYYTILDEWQLTKNVILAIEDYDELL
EENPYLRDSLDYRMRYFNILNYIQLELIKRQRRGELSPDEERLIHVTINGIATGLRNSG
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttcaaaaattagaaaattacaataataaggaagtcatccaagaagaagttacg
attttgacggacttactagaagaagttacacaaaatatgttaagtcctgaaacctttgaa
aaaatcatcgctttaaaagaattggcagcagttggaaattacgaaggattaaatgaaatt
gttcagaatctgtctaacaaggaaatgtcctatatttcacgttatttttctatcttgcct
cttttaatcaatatttcagaagacgttgatttagcttttgaaattaactatcaaaataat
gttggtcaagattatcttggaaaattatccacaacaattgatttagttgctgaaagggaa
aatgccgctgaaattttggaacacttaaatgttgtaccagttttaacagctcatccaact
caagtacaacggacgaccatgctggatttaacaaatcatattcacgttttgttgcgtaaa
tatcgcgatgtgcggatgggattgctcaatgaagaaaaatggcataatgatcttcgtcgc
tatatcgaaattattatgcgtacggatatgattcgtgagaaaaaattaaaagtgacgaat
gaaatcaccaatgtgatggaatattacaatagttctctcttgcaggcggtgacaaatcta
acagaagaatataagcgtctagctaaaaagcatgggattagcttgaaaaatcccacaccc
attacaatgggaatgtggattggtggtgaccgggatgggaatccatatgttacatccgaa
acattgaaaaaatctgctttgacacaatgtgaagtgattatgaattactacgatgcgaaa
attgccaatctgtatcgtgaattctctttgtcaacaggtatcgttaaagtcagtgaagcg
gtgcaggaaatggcttatctgtcagaagataattctatttatcgcgaaaaagagctgtat
cgccgtgctttttactacattcaaacaaaactgaaaaataccaagacttactttattgac
cagacagaagtagaaccacactatcataatattgaagaatttaaacatgatttgctagct
atcaaacaatctcttcttgaaaacaaaggagaggcaatgatttctggtgaatttaccgaa
ttgttgcaagcagtagaagtgtttggtttctatcttgcgtccattgatatgcgtcaagat
tcaagcgttcatgaagcctgtgtggcagaattgttagccagtgcaggaatagtggagcat
tatagcgagctttctgagggcgaaaaatgtcatgtcttactaaacgaactgttctatgat
ccacggattctctctgcaacacacgctgaaaaatcagatctcttacaaaaagaattacag
atttttcagacggctcgtgagttgaaggatatgttaggagatgctgtcattaaacaaacc
attatttctcatgcaacaagtgtgtccgatcttttagagttggctgtgatgcataaggaa
gttggtctcattgacaaggaatctgcacgcgtacagattgtaccgctctttgaaaccatt
gaagatttggataattcctatgatacgatgaagaaatatttatctcttcctattgctcaa
aaatggattgcctctaataataactatcaggaaatcatgcttggttattcagatagtaat
aaagacggtggctacttatcatcctgttggaccctctataaagctcaacagcgactaaca
gctattggagatgaatttggtgtgaaaatcaccttcttccacggacgtggtgggacagtt
ggacgtggtggtggtcctacttatgaagctattacctcgcagccactccgcagtatcaat
gaccgaattcgcctgacagagcaaggagaagtcattggtaataaatacggaaataaggat
gccgcttactacaatttggaaatgttggtttcagcgacgatcaacagaatgattacaaag
aaaaagagcgatactaatacgtccaatcattacgaatccattatggatcaggtggtagac
cgaagctaccaaatttatcgtgatttagtctttggcaatgagcatttttatgattatttc
tttgaatcaagcccaatcaaagctatttctagttttaatattggttcaagaccggctgct
cgtaaaactattacggaaatcggtggtttacgtgctattccatgggtcttctcatggtcg
caaagtcgtgtgatgtttcctggatggtatggtgttggatctagttttaaagaatttatt
gatgaaaatccaaaagaaaatctagcttttttaagaaagatgtataaaaattggcctttc
tttcgatcacttttgtctaatgtggacatggtgttatctaagtcgaatatgaatatcgcc
tttgaatatgcaaaactatgcgaagatgaaaaagttcaagaaatctattacacaatttta
gatgaatggcagttgaccaagaatgtcattcttgctattgaagattatgatgaattgtta
gaggaaaatccatacttgcgagacagtttggattaccgcatgcgttattttaatatcttg
aattatattcagttagaactcatcaaacgccaacgccgtggagagttatctcctgacgaa
gaaaggttgattcatgttacaatcaatggaattgcgactggactgagaaattcaggctga

DBGET integrated database retrieval system