KEGG   Streptococcus intermedius B196: SIR_1342Help
Entry
SIR_1342          CDS       T02830                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sib  Streptococcus intermedius B196
Brite
KEGG Orthology (KO) [BR:sib00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SIR_1342 (ahpF)
Enzymes [BR:sib01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SIR_1342 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_3 Thi4 DAO Glutaredoxin FMO-like Ribosomal_L21p NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGU76702
UniProt: T1ZGT3
LinkDB All DBs
Position
complement(1409624..1411156)
Genome map
AA seq 510 aa AA seqDB search
MTLDKTIKAQLKQYLGLLESDVVFQASLGQDERSAKVQAFLEEIVAMSPRLSLENIAASR
QPSFTIAQAGQTGRVQFAGLPLGHEFTSFVLALLQVSGRAPKVEDAVIDRIRAIKQTLHF
ETYVSLTCHNCPDVVQALNMMAILNPTISHTMVEGGMFREEVENKKVMAVPTVFLNGDEF
ANGRMTIEQLLDKLSGPASSEEFDKKEPFDVLVVGGGPAGSSAAIYAARKGIRTGMVVET
FGGQVMETVGIENMIGTPYTEGPKLMAQVEEHTKKYPIDIMKNQRVQNIEKKDLIEVELE
NGAILKTKTAILSVGARWRNVNVPGEEEFRTKGVTNCPHCDGPIFTGKKVAVIGGGNSGI
EAAIDLAGLAEHVYVFEFLPTLKADQVLQDRVHQLKNVTVLTNVATKEIHGSDQVEAITY
LNRENNEEHKIELSGVFVQIGLLPNTDWLKNSSVALNERGEIIVDKHGATNVPGIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgactttagataaaacaattaaagcacaacttaagcagtatttgggtcttctagaatct
gatgttgtgtttcaagcttctttaggtcaagatgaacgttctgcaaaagtgcaagcattt
ttagaagaaatcgttgcaatgtctcctcgtttatcgttggaaaatatagcagctagccgt
cagccaagttttactattgctcaagcaggacaaacgggacgtgttcagtttgcaggtctt
cctttgggacatgaattcacatcttttgtgcttgctttgctgcaagtttctggtcgtgca
ccaaaagtagaagatgctgttatagatcgaattcgagcgattaaacagacacttcatttt
gaaacttatgtcagcttaacctgtcataattgtccagatgttgtacaagctcttaatatg
atggctattctgaatccaaccattagtcacacaatggttgaaggaggtatgtttagagaa
gaagttgaaaataaaaaagtcatggctgttccaacagtttttctcaatggagacgaattt
gcaaatggtcgaatgactattgaacaattgcttgataaactttctggccctgcttcaagt
gaagaatttgataaaaaagaaccatttgatgtgttggttgttgggggtggccctgctggg
agcagtgcagccatttatgctgctcgtaagggaattcgtacaggtatggtcgttgaaacc
tttggtggccaggtaatggagaccgttggtattgaaaatatgattggtactccctataca
gaaggacctaaactgatggcgcaagtagaagaacataccaagaaatatccgattgatatc
atgaagaatcaacgtgtgcaaaacattgagaaaaaggatttgattgaagtggagcttgaa
aatggagccattctgaaaacaaaaacggctattctctctgttggagctcgttggcgaaat
gtcaatgttcctggtgaagaagaattccgaaccaaaggtgtcaccaattgtcctcattgt
gatggtcctatttttactggtaaaaaagtagctgttatcggcggaggcaattctgggatt
gaagcagcgattgacttagcgggccttgcagaacatgtttatgtgttcgaatttctacca
accttgaaagctgatcaagtcttacaagatcgagtgcaccaacttaaaaacgtgactgtt
ttaaccaatgtagcaacaaaagaaattcatggttccgatcaagttgaagctattacttat
cttaaccgtgagaataatgaagagcataaaattgagcttagtggtgtctttgttcaaatt
ggcctcttgcctaatacagactggttgaagaacagttcggttgctctcaatgagcgcggt
gaaatcattgttgataaacatggtgcgacaaatgttcctggaatttttgcagcaggtgat
tgtacagatagtgcctataaacaaatcattatttcaatgggatcaggagcaacagcggct
ctaggagcatttgattatttgattcgtcaataa

DBGET integrated database retrieval system