KEGG   Sulfolobus islandicus LAL14/1: SiL_0068Help
Entry
SiL_0068          CDS       T02620                                 

Definition
(GenBank) Uncharacterized protein conserved in archaea
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sic  Sulfolobus islandicus LAL14/1
Pathway
sic00620  Pyruvate metabolism
sic00680  Methane metabolism
sic00720  Carbon fixation pathways in prokaryotes
sic01100  Metabolic pathways
sic01120  Microbial metabolism in diverse environments
sic01200  Carbon metabolism
Module
sic_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SiL_0068
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiL_0068
   00680 Methane metabolism
    SiL_0068
Enzymes [BR:sic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SiL_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AGJ61549
UniProt: M9U3G4
LinkDB All DBs
Position
61119..62633
Genome map
AA seq 504 aa AA seqDB search
MSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTHVVRKLLS
NYPDYFREHILGKDVFLTYRLPNPKVEGADRKVFAETMESIPITYDLAEKFYGNGITVPV
FEVILPMTTSNLEIISVARYYEKAVANEDELELYDGVKVKDLVGEIYPKVIEVIPLVEDR
DSLQNIDNIVEGYYKVIKPKYMRVFLARSDPAMNYGMITAVLSVKIALSELYKLSESLNF
EIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSAISSINNS
RIGPAKILEKYEEDVLRKITILYTERYQPIIESLANAINDVSMLLPRRRARKLHIGLFGY
SRSAGKVSLPRAISFVGSLYSIGIPPELIGISSLSNLDEKEWDIFKQNYVNFKHDLQTAA
RFFNWESFELIKDIWKISEDTIAKIKEDIDYAESVIGIKLGDIDYDSRKHILMSSLFLLS
FKEKILQESKKYLYEMALIRRSLG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaacatcccgataatgcgaaagtaccagagtgggcaaaaagcgaagttatt
gaaggagaagatgaagttaaagaagccttcctagcttatagtatgtatggagttcatgag
gtaatgtgggatgctgagggaaaagacgtagatactcatgtggtaagaaagttattgtca
aattatccagactactttagagaacatattttaggtaaagatgtatttttaacttatagg
ttacctaacccaaaggtggaaggtgctgatagaaaagtatttgccgaaaccatggagagc
attccaataacttatgatttggcagagaaattttacggtaatgggattacggtaccagtt
tttgaagtaattttaccaatgacaactagtaatttggagataataagtgtggctaggtat
tacgaaaaagcagttgcaaatgaagatgaactagaactttacgatggtgtaaaagtaaag
gatttagttggagaaatatatcctaaagtaatagaagttataccactagtcgaagatagg
gactctcttcaaaatattgacaatatagtggaggggtattataaggtaattaaacctaag
tatatgagagtctttttagccaggtcggatccagcaatgaattatggaatgataacagct
gttctgtcagtaaagattgccttaagtgagttatacaaactttcagaatcgttaaacttt
gaaatatatccaataattggtgttggttcacttccatttagaggccatttatctcctgaa
aactatgaaaaagtattggaagagtataagggagtttatacatatacgattcaatcagcg
tttaagtatgactatgattacgacaaagtaaaaagtgctatttcttcaataaataactca
cggattggcccagctaaaatattggaaaagtacgaggaggatgttctaagaaagataacg
atcttatatactgaacgttaccagccaattatagaaagtcttgcaaacgctataaatgac
gtctccatgttacttcctagaagaagagccagaaaacttcatattggcctttttggatat
tctagaagcgcaggcaaggttagcttacctagggcaatttctttcgtgggttcactatat
tcaataggaataccaccagaactaataggaatttcgtctttaagcaatttagatgagaaa
gagtgggatatattcaaacagaattacgttaattttaaacacgatctccaaactgctgcg
agattctttaattgggagtcgttcgaattaattaaggatatatggaaaattagtgaggat
actatagcaaagatcaaggaagatatcgattacgctgagagcgtgataggcataaaatta
ggcgacatagattacgatagtagaaaacacatcctaatgtcttcgctatttttactatca
tttaaagagaaaatccttcaagaatctaagaagtatttatatgagatggcattaattaga
agatccttgggatga

DBGET integrated database retrieval system