KEGG   Sulfolobus islandicus LAL14/1: SiL_1799Help
Entry
SiL_1799          CDS       T02620                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sic  Sulfolobus islandicus LAL14/1
Pathway
sic03030  DNA replication
sic03410  Base excision repair
sic03420  Nucleotide excision repair
sic03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sic00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SiL_1799
   03410 Base excision repair
    SiL_1799
   03420 Nucleotide excision repair
    SiL_1799
   03430 Mismatch repair
    SiL_1799
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sic03032]
    SiL_1799
   03400 DNA repair and recombination proteins [BR:sic03400]
    SiL_1799
Enzymes [BR:sic01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SiL_1799
    6.5.1.6  DNA ligase (ATP or NAD+)
     SiL_1799
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SiL_1799
DNA replication proteins [BR:sic03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    SiL_1799
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     SiL_1799
DNA repair and recombination proteins [BR:sic03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SiL_1799
   NER (nucleotide excision repair)
    Other NER factors
     SiL_1799
   MMR (mismatch exicision repair)
    Other MMR factors
     SiL_1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AGJ63245
UniProt: M9UG84
LinkDB All DBs
Position
1653472..1655277
Genome map
AA seq 601 aa AA seqDB search
MEFKVIAEYFDKLEKISSRLQLTALLADLLSKSDKAIIDKVVYIIQGKLWPDFLGYPELG
IGEKFLIKAISIATNTDENSVENLYKSIGDLGEVARRLKSKQQSTGILGFLGTSSKESLK
VDEVYSTLSKVALTTGEGSRDLKIRLLAGLLKKADPLEAKFLVRFVEGRLRVGIGDATVL
DAMAIAFGGGQSASEIVERAYNLRADLGNIAKIIVDKGIEALKTLKPEVGIPIRPMLAER
LSNPEEILKKVGGSALVDYKYDGERAQIHKKDDKIFIFSRRLENITSQYPDVVEYISKYT
EGKEFIIEGEIVAVDPESGEMRSFQELMHRKRKSDIYEAIKEYPVNVFLFDLMYYEDVDY
TTKPLEVRRKLLESIVKPNDYVKIAHHIQVNNVEDLKSFFYRAISEGGEGVMVKAIGKDA
IYQAGARGWLWIKLKRDYQSEMADTVDLVVVGGFYGKGKRGGKISSLLMAAYNPKTDTFE
SVCKVASGFSDEQLDELQKKLMEIKRDIKHPRVNSKMEPDIWVEPVYVAEIIGAEITISP
LHTCCQGVVEKDAGLSIRFPRFIRWRDDKSPEDATTTDEILEMYNKQPKKKIESPPIDES
V
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaagttattgccgaatactttgataaattagagaagatatcttcaaggctc
cagcttacagctttactggctgatcttttaagcaaaagtgataaggcaattatagataag
gtagtttatattatacaaggcaaattatggcctgattttctaggttatccagagcttgga
attggagagaaattcttaataaaagcaattagtatagctacgaacacagatgaaaattca
gtagaaaatctctataagtcaataggtgatcttggagaagtagctcgaaggttgaaaagt
aagcagcaaagtacaggaattttaggttttttgggtacatcaagtaaagagagcttaaaa
gtggatgaagtttactctacgttatctaaggtggcattaactacgggagagggtagtaga
gatttaaagataagattactggcaggattgttaaaaaaggcagatccgttagaggccaag
ttcctagttaggtttgttgaaggtcgacttagagttggtataggagatgcgacagtttta
gatgctatggcaatagcttttggcggggggcaatcagcatcagaaatagttgaaagagct
tataatcttagggcggatctaggaaacattgcaaaaattatagtagataagggaattgaa
gccttaaagactctaaaacctgaagttggaataccaattagaccgatgctagctgaaagg
ttatcaaatcctgaagaaatattaaagaaagtaggtggaagtgcattagtcgattataaa
tacgatggagagagggcccaaatacacaaaaaagatgacaaaatttttatattttctcga
agattagagaacattacttctcagtatccagatgtagtagagtatattagtaaatacact
gaaggcaaagagttcattatagaaggagaaatagtggctgtagatccagaaagcggtgag
atgagatcatttcaagaattaatgcacagaaagaggaagtcagatatttacgaagcaatt
aaagagtacccagtaaacgtatttctctttgatttaatgtattatgaagatgtagattat
actacaaagccattagaagttaggagaaaattgttagaaagtattgtaaaaccaaacgac
tatgtaaaaatagctcatcatattcaagttaataatgtagaggatcttaaatcgttcttc
tatcgagcaatatctgagggtggagagggagtaatggtgaaggcaattggaaaagatgca
atatatcaagccggtgctaggggttggttatggataaagcttaaacgtgattatcaaagc
gagatggctgatacagtagacttagtagttgttggtggtttctatgggaagggtaaaaga
ggcggcaagataagctcactattaatggccgcatataatcctaagactgatactttcgaa
tctgtttgcaaggtggctagtggcttctcagatgagcaacttgatgagttacagaagaag
ttaatggaaataaagagggatataaaacatcctagagttaattctaagatggaaccagat
atatgggtagagccagtttatgtagcggaaataattggagcggagataacaatatctcct
ttacatacttgttgtcaaggcgtcgtagagaaggatgctggtttatctataagatttcct
cgatttataagatggagagatgataaaagtccagaagatgctacaactactgatgagata
cttgaaatgtacaacaagcagcctaagaagaagatcgaatcaccacctatagacgagagc
gtttaa

DBGET integrated database retrieval system