KEGG   Sulfolobus islandicus M.16.4: M164_0069Help
Entry
M164_0069         CDS       T00906                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00620  Pyruvate metabolism
sid00680  Methane metabolism
sid00720  Carbon fixation pathways in prokaryotes
sid01100  Metabolic pathways
sid01120  Microbial metabolism in diverse environments
sid01200  Carbon metabolism
Module
sid_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M164_0069
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M164_0069
   00680 Methane metabolism
    M164_0069
Enzymes [BR:sid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M164_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACR40705
UniProt: C4KJI5
LinkDB All DBs
Position
61097..62632
Genome map
AA seq 511 aa AA seqDB search
MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTH
VVRKLLSNYPDYFREHILGKDVFLTYRLPNPKVEGADRKVFAETMESIPITYDLAEKFYG
NGITVPVFEVILPMTTSNLEIISVARYYEKAVANEDELELYNGVKVKDLVGEIYPKVIEV
IPLVEDRDSLQNIDNIVEGYYKVIKPKYMRVFLARSDPAMNYGMITAVLSVKIALSELYK
LSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSA
ISSINNSRIGPAKILEKYEEDVLRKITILYTERYQPIIESLANAINDVSVLLPRRRARKL
HIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGISSLSNLDEKEWDIFKQNYVNFK
HDLQTAARFFNWESFELIKDIWKISEDTIAKIKEDIDYAESVIGIKLGDIDYDSRKHILM
SSLFLLSFKEKILQESKKYLYEMALIRRSLG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcataccacgtactatgtcaacacaacatcccgataatgcgaaagtaccagag
tgggcaaaaagcgaagttatcgaaggagaagatgaagttaaagaagccttcctagcttat
agtatgtatggagttcatgaggtaatgtgggatgctgagggaaaagacgtagatactcat
gtggtaagaaagttattgtcaaattatccagactactttagagaacatattttaggtaaa
gatgtatttttaacttataggttacctaacccaaaggtagaaggtgctgatagaaaagta
tttgccgaaaccatggagagcattccaataacttatgatttggcagagaaattttacggt
aatgggattacggtaccagtttttgaagtaattttaccaatgacaactagtaatttggag
ataataagtgtggctaggtattacgaaaaagcagttgcaaatgaagatgaactagaactt
tacaatggtgtaaaagtaaaggatttagttggagaaatatatcctaaagtaatagaagtt
ataccactagtcgaagatagggactctcttcaaaatattgacaatatagtggaggggtat
tataaggtaattaaacctaagtatatgagagtctttttagccaggtcggatccagcaatg
aattatggaatgataacagctgttctgtcagtaaagattgccttaagtgagttatacaaa
ctttcagaatcgttaaactttgaaatatatccaataattggtgttggttcacttccattt
agaggccatttatctcctgaaaactatgaaaaagtattggaagagtataagggagtttat
acatatacgattcaatcagcgtttaagtatgactatgattacgacaaagtaaaaagtgct
atttcttcaataaataactcacggattggcccagctaaaatattggaaaagtacgaggag
gatgttctaagaaagataacgatcttatatactgaacgttaccagccaattatagaaagt
cttgcaaacgctataaatgacgtctccgtgttacttcctagaagaagagccagaaaactt
catattggcctttttggatattctagaagcgcaggcaaggttagcttacctagggcaatt
tctttcgtgggttcactatattcaataggaataccaccagaactaataggaatttcgtct
ttaagcaatttagatgagaaagagtgggatatattcaaacagaattacgttaattttaaa
catgatctacaaactgctgcgagattctttaattgggagtcgttcgaattaattaaggat
atatggaaaattagtgaggatactatagcaaagatcaaggaagatatcgattacgctgag
agcgtgataggcataaaattaggcgacatagattacgatagtagaaaacacatcctaatg
tcttcgctatttttactatcatttaaagagaaaatccttcaagaatctaagaagtattta
tatgagatggcattaattagaagatccttgggatga

DBGET integrated database retrieval system