KEGG   Sulfolobus islandicus M.16.4: M164_1215Help
Entry
M164_1215         CDS       T00906                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00500  Starch and sucrose metabolism
sid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M164_1215
Enzymes [BR:sid01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     M164_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: ACR41821
UniProt: C4KGV7
LinkDB All DBs
Position
1153501..1154844
Genome map
AA seq 447 aa AA seqDB search
MKRIILGFEVHQPFRIRRDFFWNPRFRQSLEDRFFDTERNKDIFERIKKNCYIPATNIIL
NSIERAEEEGKDVKYFFSISGTFLEQAERWGREVIDLFQQLAYTHKVEFLAQTYYHSVTG
LWEDKSEWREQVKMHRDAIKSYFGQYPTTFENTELITKRDIIEEAERMGFKMMLSEGTSR
NLRGRSPNYVYKLKGHEIRILFRNYILSDDIAFRFSNPNWDQYPLTASKYADWISKSEGN
VGLIFVDYETFGEHHKEHTGILEFLKWLPIELENKGVEMMMPKDVYNDVYDEIEISHTTS
WADIEKDEKSWLGNIMQWAYDDAVRRTEMPSRELGNEYLRVWRYFTTSDNYYYLYLGHGS
PAEVHSYFNAFGSPIDAFINEFYAISTFIHEEINKLNIKNEPYIFMLGDKRASIAWNEKE
FMEIVMRDERFKTHLKNLRQWLGNEKD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataatattaggatttgaagttcatcagccgttcaggattagaagagatttc
ttctggaacccgagatttaggcaaagcttagaggataggtttttcgatactgagagaaat
aaggatatatttgagagaataaagaagaactgctatatccctgcaactaatataatacta
aactccattgaaagagctgaagaggaaggtaaagacgttaaatacttcttttcaatttca
ggtactttcttagagcaagctgaaagatggggaagagaagtaatagacttgtttcaacaa
ttggcttacactcataaagttgaatttctagcacaaacatactatcactcagtaactggt
ctttgggaggataaaagtgaatggagagagcaagttaagatgcatagggatgctataaaa
tcgtattttgggcaatatcctactacttttgaaaacactgaattaataactaaaagggat
attatagaagaagctgaaaggatgggctttaagatgatgttaagcgaagggactagtagg
aatttaagaggaagaagtccaaattatgtctataaattaaagggacatgagattagaata
ttgtttagaaattacatattaagtgacgatatagccttcaggttttctaatccaaattgg
gatcaatatccgttaacggcttccaaatacgctgattggataagtaagagtgagggaaat
gtgggattaatattcgtagattacgagacttttggagaacatcacaaagagcatactgga
attttagaatttctcaaatggctaccaatagagcttgagaataaaggggtggaaatgatg
atgccaaaggacgtttacaatgatgtctatgatgaaatagagatctctcacactacctca
tgggcggatatagaaaaggatgagaaaagttggttaggtaatataatgcaatgggcttac
gacgacgcagttagaaggactgagatgccctcaagggaattggggaatgagtacttaaga
gtttggaggtatttcactacaagcgataattactattatctttatttagggcatgggagt
ccagctgaagtacattcctatttcaacgcctttggatctcctatagacgcatttataaat
gaattttatgcaatatcgacatttatacatgaggagataaataaattaaatattaagaat
gagccttatatatttatgttaggagataagagagcgtcaatagcttggaatgaaaaagaa
ttcatggaaattgtaatgagagatgaaaggtttaaaactcatttgaaaaacttaaggcag
tggttaggaaatgaaaaggattga

DBGET integrated database retrieval system