KEGG   Streptococcus intermedius JTH08: SCIM_0110Help
Entry
SCIM_0110         CDS       T02156                                 

Gene name
hslO
Definition
(GenBank) Hsp33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
sie  Streptococcus intermedius JTH08
Brite
KEGG Orthology (KO) [BR:sie00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sie03110]
    SCIM_0110 (hslO)
Chaperones and folding catalysts [BR:sie03110]
 Heat shock proteins
  HSP33
   SCIM_0110 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: BAM22764
LinkDB All DBs
Position
complement(139811..140683)
Genome map
AA seq 290 aa AA seqDB search
MDKIIKTISENGAFRAYVLDSTETVRTAQEKHQTLASSTVALGRTLIASQILAANEKGDT
KITVKVLGTSSLGAIITVADTKGTVKGYVQNSGVDIKKTATGEVLVGSFVGNGEFLVITD
YGTGNPYHSMTPLVSGEIGEDLAFYLTESQQTPSAVGLNVLLDTNDKVKVAGGFLLQVLP
GAKEEEITHFEKRIQEMPAISTLLESENHIEALLSAIYGNEPYKRLSEEELRFQCDCSKE
RFLNALSSLPKSDLEEMRDEDHGAEITCQFCQSTYHFDEKDLEELIRDKS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggataagattattaaaactatttcagaaaacggggctttccgagcttatgtactagat
agtaccgaaactgttcgaacagctcaggaaaaacaccagacccttgctagctcaaccgta
gcgttaggtcgcacactcattgccagtcaaatccttgccgcaaacgaaaaaggagataca
aaaatcaccgtcaaagtactagggacaagctctcttggtgcgattatcaccgtcgcagat
acaaaaggtactgtcaaaggctatgtgcaaaattccggtgtggacattaaaaaaactgca
acaggtgaagtgttggttggatcattcgttgggaatggcgaatttctcgttattacggat
tatggaactggaaatccttatcattctatgactccacttgtgtccggtgagattggagaa
gaccttgcattctatctaacagaaagtcaacaaactccttcagctgttggcttgaatgta
ctactagataccaacgacaaggtcaaggttgctggcggatttctcttgcaagttctccct
ggtgccaaagaagaagaaatcacccactttgaaaaacgaatccaagaaatgcctgctatt
tcaacacttttggaatctgaaaaccatattgaagccttgctttcagctatctatggcaac
gaaccctacaaacgcttgtcagaagaagagctccgcttccaatgtgattgcagcaaagaa
cggtttttaaatgccctctcaagcctacctaagtcagatcttgaagaaatgcgagatgaa
gaccacggcgctgaaatcacttgccaattctgtcaaagcacatatcattttgacgaaaaa
gacttggaggaactcattcgtgacaaatcttaa

DBGET integrated database retrieval system