KEGG   Streptococcus intermedius JTH08: SCIM_0364Help
Entry
SCIM_0364         CDS       T02156                                 

Gene name
nox1
Definition
(GenBank) NADH oxidase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sie  Streptococcus intermedius JTH08
Brite
KEGG Orthology (KO) [BR:sie00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCIM_0364 (nox1)
Enzymes [BR:sie01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SCIM_0364 (nox1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_3 DAO Thi4 Glutaredoxin FMO-like NAD_binding_8 Ribosomal_L21p
Motif
Other DBs
NCBI-ProteinID: BAM23018
LinkDB All DBs
Position
418236..419768
Genome map
AA seq 510 aa AA seqDB search
MTLDKTIKAQLKQYLGLLESDVVFQASLGQDERSAKVQAFLEEIVAMSPRLSLENIAASR
QPSFTIAQAGQTGRVQFAGLPLGHEFTSFVLALLQVSGRAPKVEDAVIDRIRAIKQTLHF
ETYVSLTCHNCPDVVQALNMMAILNPTISHTMVEGGMFREEVENKKVMAVPTVFLNGDEF
ANGRMTIEQLLDKLSGPASSEEFDKKEPFDVLVVGGGPAGSSAAIYAARKGIRTGMVVEN
FGGQVMETVGIENMIGTPYTEGPKLMAQVEEHTKKYPIDIMKNQRVQNIEKKDLIEVELE
NGAILKTKTAILSVGARWRNVNVPGEEEFRTKGVTNCPHCDGPIFTGKKVAVIGGGNSGI
EAAIDLAGLAEHVYVFEFLPTLKADQVLQDRVHQLKNVTVLTNVATKEIHGSDQVEAITY
LNRENNEEHKIELSGVFVQIGLLPNTDWLKNSSVALNERGEIIVDKQGATNVPGIFAAGD
CTDSAYKQIIISMGSGATAALGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgactttagataaaacaattaaagcacaacttaagcagtatttgggtcttctagaatct
gatgttgtgtttcaagcttctttaggtcaagatgaacgttctgcaaaagtgcaagcattt
ttagaagaaatcgttgcaatgtctcctcgtttatcgttggaaaatatagcagctagccgt
cagccaagttttactattgctcaagcaggacaaacgggacgtgttcagtttgcaggtctt
cctttgggacatgaattcacatcttttgtgcttgctttgctgcaagtttctggtcgtgca
ccaaaagtagaagatgctgttatagatcgaattcgagcgattaaacagacacttcatttt
gaaacttatgtcagcttaacctgtcataattgtccagatgttgtacaagctcttaatatg
atggctattctgaatccaaccattagtcacacaatggttgaaggaggaatgtttagagaa
gaagttgaaaataaaaaagtcatggctgttccaacagtttttctcaatggagacgaattt
gcaaatggtcgaatgactattgaacaattgcttgataaactctctggccctgcttcaagt
gaagaatttgataaaaaagaaccatttgatgtgttggttgttgggggtggccctgctggg
agcagtgcagccatttatgctgctcgtaagggaattcgtacaggtatggtcgttgaaaac
tttggcgggcaggtaatggagactgttggtattgaaaatatgattggtactccctataca
gaaggccctaaactgatggcgcaagtagaagaacataccaagaaatatccgattgatatc
atgaagaatcaacgtgtgcaaaacattgagaaaaaggatttgattgaagtggagcttgaa
aatggagctattctgaaaacaaaaacggctattctctctgttggggctcgttggcgaaat
gtcaatgttcctggtgaagaagaattccgaaccaaaggtgtcaccaattgtcctcattgt
gacggtcctatttttactggtaaaaaagtagctgttatcggcggaggcaattctgggatt
gaagcagcgattgacttagcgggtcttgcagaacatgtttatgtgttcgaatttctacca
accttgaaagctgatcaagtcttacaagatcgagtgcaccaacttaaaaacgtgactgtt
ttaaccaatgtagcaacaaaagaaattcatggttccgatcaagttgaagctattacttat
cttaaccgtgagaataatgaagagcataaaattgagcttagtggtgtctttgttcaaatt
ggcctcttgcctaatacagactggttgaagaacagttcggttgctctcaatgaacgcggt
gaaatcattgttgataaacagggtgcgacaaatgttcctggaatttttgcagcaggtgat
tgtacagatagtgcctataaacaaatcattatttcaatggggtcaggagcaacagcagct
ctaggagcatttgattatttgattcgtcaataa

DBGET integrated database retrieval system