KEGG   Streptococcus intermedius JTH08: SCIM_0493Help
Entry
SCIM_0493         CDS       T02156                                 

Gene name
sodA
Definition
(GenBank) manganese-dependent superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sie  Streptococcus intermedius JTH08
Brite
Enzymes [BR:sie01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SCIM_0493 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAM23147
LinkDB All DBs
Position
558233..558838
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPYIDEETMHLHHDKHHNTYVTNVNAALAKHPEIGKDLEQLLADV
ESIPVDIRQAVINNGGGHLNHSLFWELMTPEETAPSAELAADLEATFGSFDDFKTAFTTA
ATIRFGSGWAWLVVNKEGKLEVMSTANQDTPISEGKTPILGIDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVNELYKAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttacctgatctaccttatgcttatgatgctttggaaccatatattgat
gaagaaaccatgcatttgcatcatgacaaacatcataatacctatgtaaccaacgtgaat
gctgcactggcaaaacatcctgagattggcaaggatttagaacaacttttagctgatgta
gagtctattccagtcgatattcgtcaagcggttattaataatggtggtggacatttgaat
catagtcttttttgggaattgatgacaccagaagaaacagcaccatcagcagaattagcg
gcagaccttgaagcaacatttggttcatttgacgatttcaaaacagcctttacaacagct
gcaacaattcgtttcggttcaggctgggcttggctagtggtaaacaaagaaggtaagcta
gaagtgatgtcaactgctaaccaagatacgccaatctctgaaggaaaaacacctattttg
ggaattgatgtttgggagcatgcttactatgtgaaatatcgcaatgttcgcccagactac
attaaggctttcttttcagttatcaactggaataaggtcaatgaattgtacaaagcagcg
aaataa

DBGET integrated database retrieval system