KEGG   Streptococcus intermedius JTH08: SCIM_0601Help
Entry
SCIM_0601         CDS       T02156                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sie  Streptococcus intermedius JTH08
Pathway
sie00620  Pyruvate metabolism
sie00680  Methane metabolism
sie01100  Metabolic pathways
sie01120  Microbial metabolism in diverse environments
sie01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sie00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCIM_0601 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SCIM_0601 (ppc)
Enzymes [BR:sie01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SCIM_0601 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAM23255
LinkDB All DBs
Position
700390..703089
Genome map
AA seq 899 aa AA seqDB search
MSLQKLENYNNKEVIQEEVTILTDLLEEVTQNMLSPETFEKIIALKELAAVGNYEGLNEI
VQNLSNKEMFYISRYFSILPLLINISEDVDLAFEINYQNNVGQDYLGKLSTTIDLVAEKE
NAAEILEHLNVVPVLTAHPTQVQRTTMLDLTNHIHVLLRKYRDVRMGLLNEEKWHNDLRR
YIEIIMRTDMIREKKLKVTNEITNVMEYYNSSLLQAVTNLAEEYKRLAKKHGISLKNPTP
ITMGMWIGGDRDGNPYVTSETLKKSALTQCEVIMNYYDAKIANLYREFSLSTGIVKVSEA
VQEMAYLSEDNSIYREKELYRRAFYYIQTKLKNTKTYFIDQAEVEPHYHNIEEFKHDLLA
IKQSLLENKGEAMISGEFTELLQAVEVFGFYLASIDMRQDSSVHEACVAELLASAGIVEH
YSELSEGEKCHVLLNELLYDPRILSATHAEKSDLLQKELQIFQTARELKDMLGDAVIKQT
IISHATSVSDLLELAVMHKEVGLIDKESARVQIVPLFETIEDLDNSYDTMKKYLSLPIAQ
KWIASNNNYQEIMLGYSDSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKITFFHGRGGTV
GRGGGPTYEAITSQPLRSINDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSATINRMITK
KKSDTNTSNHYESIMDQVVDRSYQIYRDLVFGNEHFYDYFFESSPIKAISSFNIGSRPAA
RKTITEIGGLRAIPWVFSWSQSRVMFPGWYGVGSSFKEFIDENPKENLAFLRKMYKNWPF
FRSLLSNVDMVLSKSNMNIAFEYAKLCEDEKVQEIYYTILDEWQLTKNVILAIEDYDELL
QENPYLRDSLDYRMRYFNILNYIQLELIKRQRRGELSPDEERLIHVTINGIATGLRNSG
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttcaaaaattagaaaattacaataataaggaagtcatccaagaagaagttacg
attttgacggacttactagaagaagttacacaaaatatgttaagtcctgaaacctttgaa
aaaatcatcgctttaaaagaattggcagcagttggaaattacgaaggattaaatgaaatt
gttcagaatctgtctaacaaggaaatgttctatatttcacgttatttttctatcttgcct
cttttaatcaatatttcagaagacgttgatttagcttttgaaattaactatcaaaataat
gttggtcaagattatcttggaaaattatccacaacaattgatttagttgctgaaaaggaa
aatgccgctgaaattttggaacacttaaatgttgtaccagttttaacagctcatccaact
caagtacaacggacaaccatgctggatttaacaaatcatattcacgttttgttgcgtaaa
tatcgcgatgtgcggatgggattgctcaatgaagaaaaatggcataatgatcttcgtcgc
tatatcgaaattattatgcgtacggatatgattcgtgagaaaaaattaaaagtgacgaat
gaaatcaccaatgtgatggaatattacaatagttctctcttgcaggcggtgacaaatcta
gcagaagaatataagcgtctagctaaaaagcatgggattagcttgaaaaatcccacaccc
attacaatgggaatgtggattggtggtgaccgggatgggaatccatatgttacatccgaa
acattgaaaaaatctgctttgacacaatgtgaagtgattatgaattactacgatgcgaaa
attgccaatctgtatcgtgaattctctttgtcaacaggtatcgttaaagtcagtgaagcg
gtgcaggaaatggcttatctgtcagaagataattctatttatcgcgaaaaagagctgtat
cgccgtgctttttactacattcaaacaaaactgaaaaataccaagacttactttattgac
caggcagaagtagaaccacactatcataatattgaagaatttaaacatgatttgctagct
atcaaacaatctcttcttgaaaacaaaggagaggcaatgatttctggtgaatttactgaa
ttgttgcaagcagtagaagtgtttggtttctatcttgcgtccattgatatgcgtcaagat
tcaagcgttcatgaagcctgtgtggcagaattgttagccagtgcaggaatagtggagcat
tatagcgagctttctgagggcgaaaaatgtcatgtcttactaaacgaactgctctatgat
ccacggattctctctgcaacacacgctgaaaaatcagatctcttacaaaaagaattacag
atttttcagacggctcgtgagttgaaggatatgttaggagatgctgtcattaaacaaacc
attatttctcatgcaacaagtgtatccgatcttttagagttggctgtaatgcataaggaa
gttggtctcattgacaaggaatctgcacgcgtgcagattgtaccgctctttgaaaccatt
gaagatttggataattcctatgatacgatgaagaaatatttatctcttcctattgctcaa
aaatggattgcctctaataataactatcaggaaatcatgcttggttattcagatagtaat
aaagacggtggctacttatcatcctgttggaccctctataaagctcaacagcaattaaca
gctattggagatgagtttggtgtgaaaatcaccttcttccacggacgtggtgggacagtt
ggacgtggtggtggtcctacttatgaagctattacctcgcagccactccgcagtatcaat
gaccgaattcgcctgacagagcaaggagaagtcattggtaataaatacggaaataaggat
gccgcttactacaatttagaaatgttggtttcagcgacgatcaacagaatgattacaaag
aaaaagagcgatactaatacgtccaatcactacgaatccattatggatcaggtggtagac
cgaagctatcaaatttatcgtgatttagtctttggcaatgagcatttttatgattatttc
tttgaatcaagcccaatcaaagctatttctagttttaatattggttcaagaccggctgct
cgtaaaactattacggaaatcggtggtttacgtgctattccatgggtcttctcatggtcg
caaagtcgtgtgatgtttcctggatggtatggtgttggatctagttttaaagaatttatt
gatgaaaatccaaaagaaaatctagcttttttaagaaagatgtataaaaattggcctttc
tttcgatcacttttatctaatgtggacatggtgttatctaagtcgaatatgaatatcgcc
tttgaatatgcaaaactatgcgaagatgaaaaagttcaagaaatctattacacaatttta
gatgagtggcagttgaccaagaatgtcattttggctattgaagattatgatgaattgtta
caggaaaatccatacttgcgagacagtttggattaccgcatgcgttattttaatatcttg
aattatattcagttagaactcatcaaacgccaacgccgtggagagttatctcctgacgaa
gaaaggttgattcacgtcacaatcaatggaattgcgactggactgagaaattcaggctga

DBGET integrated database retrieval system