KEGG   Streptococcus intermedius JTH08: SCIM_1285Help
Entry
SCIM_1285         CDS       T02156                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sie  Streptococcus intermedius JTH08
Pathway
sie00220  Arginine biosynthesis
sie00250  Alanine, aspartate and glutamate metabolism
sie00290  Valine, leucine and isoleucine biosynthesis
sie01100  Metabolic pathways
sie01110  Biosynthesis of secondary metabolites
sie01130  Biosynthesis of antibiotics
sie01210  2-Oxocarboxylic acid metabolism
sie01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sie00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCIM_1285
   00290 Valine, leucine and isoleucine biosynthesis
    SCIM_1285
   00220 Arginine biosynthesis
    SCIM_1285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sie01007]
    SCIM_1285
Enzymes [BR:sie01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCIM_1285
    2.6.1.66  valine---pyruvate transaminase
     SCIM_1285
Amino acid related enzymes [BR:sie01007]
 Aminotransferase (transaminase)
  Class I
   SCIM_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 MHC_II_alpha Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAM23939
LinkDB All DBs
Position
complement(1465223..1466356)
Genome map
AA seq 377 aa AA seqDB search
MRANGEKILRLNTGNPAEFGFTAPDEVIHDLIMNVRDSEGYSDSKGIFSARKAIMQYCQL
KNIPNVDIDDVYLGNGVSELIVMSMQGLLDNGDEVLVPMPDYPLWTAAVSLAGGNAVHYL
CDEAADWYPDIDDIRSKITSNTKAIVVINPNNPTGALYPKEVLEELVDVARQNNLIIFAD
EIYDRLVMDGEKHIAIASLAPDLFCVSMNGLSKSHRIAGFRVGWMVLSGPKYHVKDYIEG
LNMLSNMRLCSNVLSQHVVQTSLGGYQSVDELLLPGGRIYEQRNFIYKAINEIPGLSAVK
PKAGLYIFPKIDREMYQVDDDEQFVLDFLKQEKILLVHGRGFNWKDPDHFRIVYLPRVDE
LAQIQEKMTRFLKQYRR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcaaatggtgagaaaatccttcggttgaacacaggaaaccctgctgagtttggt
tttacggcaccagatgaagtgattcatgatttgattatgaatgtacgggatagcgagggc
tattcagactcgaaagggattttttctgctcggaaagctattatgcaatattgccagtta
aagaatattccaaatgttgatattgacgatgtctaccttggaaatggagtcagcgagctg
attgtcatgtctatgcaaggtttgctagacaatggtgatgaggtgctggtacctatgccg
gattatcctctctggactgctgctgtgagtttagcaggagggaatgctgttcactatctt
tgtgatgaagctgctgattggtacccagatattgatgacattagatcgaaaattacttct
aatacaaaagctattgtcgttatcaacccaaacaatccgacaggagctctatatcctaag
gaagttttagaagagctggttgacgttgcacggcaaaataatttgattatttttgcggat
gagatttatgatcgtttagtaatggacggtgaaaagcatatagctatcgcaagtttagct
cctgatcttttctgtgttagtatgaacggtttgtctaaatcgcaccgtattgcaggcttt
cgtgtaggatggatggtgctatctggaccaaaatatcatgtaaaagattacatcgaaggg
ttaaatatgctgtcaaatatgcgtctgtgttcaaatgtcctatctcagcacgtggtacaa
acatcgcttggcggttatcaatcagtagatgagttactacttcccggtggaagaatttat
gagcaacggaattttatttataaagctattaatgaaatcccaggtctatctgcagtaaaa
cctaaagcagggctttacattttccctaaaattgatagagaaatgtatcaagtagatgat
gacgaacaattcgtgctggatttcttaaagcaagaaaagattttactggtgcatggacga
ggctttaattggaaagatcctgatcatttccggattgtttacctgcctcgtgtagatgag
ttagcacaaattcaagagaagatgactcgtttcttaaaacaatatcgacgatga

DBGET integrated database retrieval system