KEGG   Streptococcus infantarius: Sinf_0547Help
Entry
Sinf_0547         CDS       T01765                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sif  Streptococcus infantarius
Brite
Enzymes [BR:sif01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sinf_0547 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEZ61899
LinkDB All DBs
Position
569654..570265
Genome map
AA seq 203 aa AA seqDB search
MAIILPELPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHSELGDDLEVILAEL
DKIPADIRQAVINNGGGALNHSLFWELLSPEKQEPTADVLAAIEEAFGSFEDFKTAFTQA
ATTRFGSGWAWLVVNKDGKLEVTSTANQDTPLSEGKKPILALDVWEHAYYLKYRNVRPNY
IKAFFDIINWAKVAELYQAALAD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccggaactaccatacgcatatgatgcacttgaaccatacatcgat
gcagaaacaatgacattgcatcatgacaaacatcacgctacttacgtagcaaatgcaaat
gctgctcttgaaaaacactctgaacttggagatgatttagaagttatcttggcagagctt
gacaagattccagcagatattcgtcaagcggtgattaacaacggtggtggtgctcttaac
cactcacttttctgggaattgctatctcctgaaaaacaagaaccaacagcagatgtactt
gcggcaattgaagaagcatttggctcatttgaagatttcaaaacagctttcacgcaagca
gcaacaactcgctttggttcaggttgggcttggcttgttgttaacaaagatggcaaactt
gaagtaacctcaactgctaaccaagatactccactttcagaaggtaagaaaccaattctt
gctcttgatgtttgggaacatgcttactatctcaaatatcgtaacgttcgtccaaattac
atcaaagcattctttgatattatcaattgggcgaaagttgctgaattataccaagcagca
cttgctgattaa

DBGET integrated database retrieval system