KEGG   Streptococcus infantarius: Sinf_0649Help
Entry
Sinf_0649         CDS       T01765                                 

Gene name
mutX
Definition
(GenBank) mutator MutT protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
sif  Streptococcus infantarius
Brite
KEGG Orthology (KO) [BR:sif00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sif03400]
    Sinf_0649 (mutX)
Enzymes [BR:sif01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     Sinf_0649 (mutX)
DNA repair and recombination proteins [BR:sif03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Sinf_0649 (mutX)
 Prokaryotic Type
    Sinf_0649 (mutX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AEZ61997
LinkDB All DBs
Position
679178..679663
Genome map
AA seq 161 aa AA seqDB search
MTKLATICYIDNGEALLLLHRNKKPNDVHEGKWISVGGKLEAGETPDECAKREIFEETHF
KVKEMDFKGVITFPEFTPGHDWYTYVFKVTDFEGELISDEESREGTLEWVPYDKVLSKPT
WEGDYEIFKWILDDVPFFSAKFTYDDKQRLVDKSVTFYGDK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagttagcgacaatttgttatattgataacggtgaggcacttttgcttttgcat
cgtaataaaaagcctaatgatgttcatgagggaaaatggatttcggttggtggtaaactt
gaagcaggtgaaacgcctgatgaatgtgctaaacgtgaaatttttgaagaaacgcatttt
aaggttaaggaaatggattttaaaggtgtgattactttccctgaatttacgcctggtcac
gattggtatacctacgtctttaaggtgacagattttgaaggtgaattaatctctgacgaa
gaatcacgtgagggtactcttgagtgggttccttatgataaggtgttatcaaaaccaact
tgggagggtgactatgaaatctttaagtggattttagatgatgtgccattcttctcagct
aagtttacttatgatgacaagcaacgcttagtagataagagtgttactttttatggcgat
aagtag

DBGET integrated database retrieval system