KEGG   Streptococcus infantarius: Sinf_0846Help
Entry
Sinf_0846         CDS       T01765                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sif  Streptococcus infantarius
Pathway
sif00500  Starch and sucrose metabolism
sif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sinf_0846
Enzymes [BR:sif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Sinf_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AEZ62184
LinkDB All DBs
Position
complement(867606..869063)
Genome map
AA seq 485 aa AA seqDB search
MTNETLMQYFEWYLPNDGKHWKRLAADASHLAQKGITKIWMPPAFKATHDSDVGYGVYDL
FDLGEFNQKGTIRTKYGTKADYLEAISALKNNGIEPLADVILNHKAAADHTETFKVVEVA
PEDRTKVISQPFEIEGWTNFTFEGRHRAYNDFEWHWYHFTGTDYDVKTGKTGIFLIQGDN
KGWANQELVDGENGNYDYLMYADLDFKHPEVIKNIYDWADWFVETTGVKGFRLDAIKHID
SFFMRNFIRDMKAKYSNSFYVFGEFWNGDEKSNNDYLASTDYRFDLVDVRLHQNLFEASK
AKEAYDLRQIFEQTLVKNHPDSAVTFVDNHDTQRGQALESTIEEWFKPAAYALILLRQTG
LPCIFYGDYYGISGQFAQESFQTVIDKLLELRKNAVYGQELDYFDQANCIGWTCLGDDKH
PTALAVLINNSKATSKRMFVGEKWAGKLFTDALGNQAAHVQIDEQGYGDFLVGEKSISTW
IPLTK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaaactttgatgcaatactttgaatggtatttaccaaatgacggcaaacac
tggaaacgtttggcagccgatgcttctcatcttgcccaaaaaggtatcaccaaaatttgg
atgccccctgcttttaaagcgactcatgacagtgatgtgggctatggcgtctatgacctt
tttgacctaggtgaatttaaccaaaaaggaaccattcgaacaaaatacggaacaaaagct
gattatctagaagctatttcagctcttaaaaataatggtattgagcctttagctgacgtc
attttaaatcataaggctgctgctgaccacaccgaaacctttaaggttgttgaagttgct
ccagaggaccgaacaaaggttatcagtcagccttttgaaattgaagggtggacaaatttt
acctttgagggtcgccaccgtgcctacaacgactttgaatggcattggtaccactttacg
ggcacagactatgatgtcaaaactggtaaaactggcattttcctaattcaaggagacaac
aaaggttgggcaaaccaagaattggttgacggtgaaaatggaaattacgattacctcatg
tatgccgacctagatttcaaacatccagaagtcatcaaaaatatctacgattgggcagat
tggtttgttgaaacaactggagttaaggggttccgtttagacgcgattaagcacatcgat
tctttcttcatgagaaactttatccgtgatatgaaagccaagtacagcaatagtttctat
gtttttggtgaattttggaacggtgatgaaaagtcaaataatgattacctagcaagtact
gattatcggtttgatttggtcgatgttcgcctccaccaaaatctctttgaagcaagtaaa
gccaaggaagcttatgatttacgtcagattttcgagcaaactttagtgaaaaatcatcca
gattctgctgttacttttgttgataatcatgatacccagcgtggtcaagcactggaatca
actatcgaagaatggtttaaaccagcagcttatgccctcattttacttcgtcaaactgga
cttccttgcattttctacggagattattatggcatttcaggacaatttgctcaggaaagc
ttccaaactgtcattgataaattgcttgaacttagaaaaaacgccgtttatggtcaagaa
ctagattactttgaccaagctaactgtataggctggacttgccttggagatgacaaacac
cctactgctcttgctgttctcatcaacaatagtaaagccacatcaaagcgcatgtttgtt
ggagaaaaatgggctggaaaattgttcactgatgctcttggtaaccaagctgcgcatgtc
caaatcgatgagcaaggctatggcgatttcctagtcggtgaaaaatcaatcagcacttgg
ataccactaacaaaataa

DBGET integrated database retrieval system