KEGG   Streptococcus infantarius: Sinf_0850Help
Entry
Sinf_0850         CDS       T01765                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase,dihydrolipoamide acetyl transferase E2 subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sif  Streptococcus infantarius
Pathway
sif00010  Glycolysis / Gluconeogenesis
sif00020  Citrate cycle (TCA cycle)
sif00620  Pyruvate metabolism
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01120  Microbial metabolism in diverse environments
sif01130  Biosynthesis of antibiotics
sif01200  Carbon metabolism
Module
sif_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinf_0850
   00020 Citrate cycle (TCA cycle)
    Sinf_0850
   00620 Pyruvate metabolism
    Sinf_0850
Enzymes [BR:sif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sinf_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEZ62188
UniProt: H6P8S6
LinkDB All DBs
Position
872151..873494
Genome map
AA seq 447 aa AA seqDB search
MANEIIMPKLGVDMQEGEILEWKFSEGDVVNEGDILLEIMSDKTNMEIEAENSGVLLKIV
HPAGDVVPVTEVIGYIGAVGENVDDLVGEGQAEQLEPVQEASADFSQPSDAPAIFQKGKI
RATPAARKLAAERGIALDSISGTGENGRIHKDDVAKFAKVRVTPLARKIAADMGLELSGI
AGTGASGKITKDDVLAKAGADKSESSEEVHSVPDGIEVIKMSGMRQAISKGMSKSYFTAP
TFTLDYDIDMTNLLALRKQLIEPIMAKTGYKVTVTDLIGLAVTKALMKEEHRYLNASLIN
DAKAIELHHFVNLGIAVGLPDGLVVPVVHGADKMTLSDFVVASKDVIQKAQAGKLKATDM
SGSTFSITNLGMFGVKSFNPIINQPNSAILGISATVDTPVAIDGQVVIRPIMGLSLTIDH
RLVDGMNGAKFMLDLKALLENPLELLI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgagattatcatgccaaaacttggcgttgacatgcaagagggagaaattctc
gagtggaaattttccgaaggcgatgtagtgaacgaaggtgatattcttcttgaaatcatg
tccgacaaaactaatatggaaatcgaagctgaaaactcaggtgttctactgaaaatcgtg
catcctgctggcgacgtggtaccagtgactgaggtaatcggctatatcggagcagtaggg
gaaaacgttgatgatttggtgggagaaggtcaggctgaacagttagagcctgttcaggaa
gcatcagctgatttctctcaaccgtctgatgcgccagctatttttcaaaaaggtaagata
cgtgcgacaccagcagcaagaaagctagccgcagagcgtggaatcgcgcttgatagcatc
agtgggactggtgaaaatgggcgtattcataaagatgacgtggcgaagtttgctaaggtg
cgcgtgacgccgcttgctcgtaagattgcggcagatatgggccttgagctttctggtatc
gctggcactggtgctagtggcaagattactaaagatgatgtccttgctaaagcaggtgcc
gataagagtgagagtagtgaggaggttcacagtgtgccagatggtatcgaagtgattaaa
atgtctggcatgcgtcaggcgatttcaaaaggcatgtcgaagtcttactttacagctcca
actttcacgcttgattatgacatagatatgacgaatcttttggcgcttcgtaagcagttg
attgagccaatcatggcaaaaacgggctacaaggtgactgtaactgatttgattggactt
gcggttacgaaggccttgatgaaagaggagcatcgttatttaaatgcctctttgattaat
gacgcgaaagctattgagctgcatcattttgtcaatctgggtattgccgttggcttgcca
gatggtttggtggttccagttgttcatggagctgataagatgaccttgtctgattttgtg
gttgcatcaaaagatgtgattcaaaaagcgcaagctggcaaattaaaagcaactgatatg
tctgggtcaactttctctatcacaaacttagggatgtttggggttaagtcctttaaccca
attattaatcagccaaactctgctattttaggaatttcagcgactgttgatactccggtt
gccattgatggacaggtagtgattcgtccaattatgggacttagcttgaccattgatcac
cgtttggtcgacgggatgaatggcgctaaatttatgttggatttaaaagcgttgctggaa
aatcctttggaactactgatctga

DBGET integrated database retrieval system