KEGG   Streptococcus infantarius: Sinf_1243Help
Entry
Sinf_1243         CDS       T01765                                 

Gene name
pheA
Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
sif  Streptococcus infantarius
Pathway
sif00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01130  Biosynthesis of antibiotics
sif01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sif00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinf_1243 (pheA)
Enzymes [BR:sif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     Sinf_1243 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT DUF5457
Motif
Other DBs
NCBI-ProteinID: AEZ62556
LinkDB All DBs
Position
complement(1267081..1267905)
Genome map
AA seq 274 aa AA seqDB search
MKVGYLGPNGSFTHNVAVKAFPGADRVPFGNITEVIKSYEEGLVDYAIIPVENSIEGSVH
ETLDYLFHQAKIEAVAEMIQPIKQQLLATSKDKKIEKIFSHPQAIAQGKKYIKAHYPNAQ
IEMTASTAYAARFIAENPDAPFAAIAPVAAAKEYGLEIIAKDIQEMDENYTRFWVLGRKK
YAFELFKCQQKVSLALTLPDNLPGALYKALSVFAWRGINLTKIESRPLKTALGEYFFIVD
IDNTNEALVSFALEELRLLGIDYKMLGNYDVYKL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttggctatttaggaccgaatggttcttttacgcacaatgttgctgttaaggca
ttcccaggagctgatcgagtgccttttggcaacatcacagaagtgattaagtcttacgaa
gaaggtctagtggattacgccattattcctgttgaaaattctattgaagggtcagttcac
gaaactctggactacctttttcatcaagctaaaattgaagcggttgcggaaatgattcaa
cctattaagcaacaacttttagcgacttcaaaagataagaaaatcgaaaagattttctca
catccgcaggctattgctcaagggaaaaaatacatcaaagcgcattatccgaatgcacaa
atcgagatgacagcaagcacggcttatgcagcacgttttattgctgaaaatcctgatgcg
ccatttgcagcgattgctccagttgctgccgcaaaagaatatggcttagagattattgcc
aaagacatccaagaaatggatgaaaactacacgcgcttttgggtgcttggtcgaaagaaa
tacgcttttgaattgtttaagtgtcaacagaaagtgtctcttgctttgactctgccagat
aatcttccaggggcactttataaggctttgtctgtgtttgcatggcgcggaattaacttg
actaaaatcgaaagtcgtcctttgaagacagcgcttggagagtactttttcatcgttgat
attgataataccaatgaagctctggtctcttttgcgctggaagaattgcgactgttaggc
attgattataaaatgctcggaaattacgacgtttacaagttatga

DBGET integrated database retrieval system