KEGG   Streptococcus infantarius: Sinf_1602Help
Entry
Sinf_1602         CDS       T01765                                 

Definition
(GenBank) aspartate (tyrosine/aromatic) amino transferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sif  Streptococcus infantarius
Pathway
sif00220  Arginine biosynthesis
sif00250  Alanine, aspartate and glutamate metabolism
sif00290  Valine, leucine and isoleucine biosynthesis
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01130  Biosynthesis of antibiotics
sif01210  2-Oxocarboxylic acid metabolism
sif01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sif00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sinf_1602
   00290 Valine, leucine and isoleucine biosynthesis
    Sinf_1602
   00220 Arginine biosynthesis
    Sinf_1602
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sif01007]
    Sinf_1602
Enzymes [BR:sif01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Sinf_1602
    2.6.1.66  valine---pyruvate transaminase
     Sinf_1602
Amino acid related enzymes [BR:sif01007]
 Aminotransferase (transaminase)
  Class I
   Sinf_1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AEZ62905
UniProt: H6PC30
LinkDB All DBs
Position
complement(1622877..1624091)
Genome map
AA seq 404 aa AA seqDB search
MKIFDKSSKLEHVAYDIRGPILDEANRMIANGEKILRLNTGNPAAFGFQAPNEVIRDLIA
HARNSEGYSDSKGIFSARKAIMQYCQLKGFPHVDIDDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYLCDEQANWYPDIDDIKSKITSNTKAIVIINPNNP
TGALYPDDLLKEIVEIARQNDLIIFADEIYDRLVMDGKKHTAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKQNVKGYIEGLNMLANMRLCANVLGQNVVQTSLGGYQSVDELL
IPGGRIYEQRNFIYKAVNEVPGLSAVKPEAGLYIFPKIDRDMYQIDDDEQFCLELLKQEK
VMLVPGKGFNWNEPDHFRIVYLPRVEELAEVQEKLTRVLSQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttgataaatcttcaaagctagaacatgttgcatacgatattcgtgggcca
attcttgatgaagccaatcgtatgattgctaacggtgagaaaattcttcgccttaatacc
ggaaacccagctgcctttggttttcaagccccaaatgaggttatccgtgacttgattgct
cacgctcgtaatagtgaagggtattctgatagtaaagggattttttctgctcgtaaagct
atcatgcaatactgtcagttaaaaggatttccacatgtggatatcgatgatatttatcta
ggaaatggtgtctctgagcttatctcaatgtcacttcaagcccttcttgatgatggtgat
gaagtcttggtgccaatgcctgattacccattatggacagcttgtgtcagccttgctggg
ggaaatgccgttcattatctttgtgatgaacaagctaattggtatcctgatattgatgac
atcaaatccaaaatcacatcaaataccaaagccattgtcatcattaatccaaataaccca
acaggtgctttgtatcccgatgaccttttgaaagaaatcgtggaaattgctcgtcaaaat
gacttgattatttttgcagatgaaatctatgaccgtttggttatggatggcaaaaaacat
actgctattgctagcttagcaccagatgttttctgtgtgtcaatgaatggtttatcaaaa
tcacaccgaatttgtggttttcgtgttggttggatggtcctatcaggtccaaaacaaaac
gttaaaggatacattgaaggacttaacatgttagccaatatgcgtctttgcgcaaacgtc
ttaggacaaaatgttgttcagacttctctaggtggttatcaatcagtcgatgaacttttg
attcctggtggtcgtatctatgaacaacgtaacttcatttataaagcagtaaatgaagtc
cctggtttgtctgcagtgaaaccagaagcaggactttacattttccctaaaatcgaccgt
gacatgtatcaaattgatgacgatgaacagttctgtttagaactgctaaaacaagaaaaa
gtcatgttggttccaggtaaaggtttcaactggaatgaacctgaccacttccgaattgtc
tatttgccacgtgttgaagaattagctgaggttcaagagaagctaacacgcgttcttagt
cagtacaaacgttaa

DBGET integrated database retrieval system