KEGG   Streptococcus sp. I-G2: N596_00895Help
Entry
N596_00895        CDS       T02879                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sig  Streptococcus sp. I-G2
Brite
Enzymes [BR:sig01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     N596_00895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 17315415
NCBI-ProteinID: AGY39388
UniProt: U5P6R9
LinkDB All DBs
Position
148859..149464
Genome map
AA seq 201 aa AA seqDB search
MAIILPDLPYAYDALEPYIDAETMHLHHDKHHQAYVNNANAALEKHPEIGEDLEALLADV
ESIPADIRQALINNGGGHLNHALFWELMTPEKTAPSAELAAAIDAAFGSFEEFQAAFTAA
ATTRFGSGWAWLVVNKEGKLEVTSTANQDTPISEGKKPILGLDVWEHAYYVKYRNVRPDY
IKAFFSVINWNKVDELYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttaccagatcttccatacgcatacgatgcattagaaccatatattgat
gctgaaacaatgcacttgcaccatgacaaacaccaccaagcatatgtaaataacgctaat
gcagctcttgaaaaacaccctgaaatcggtgaagaccttgaagctttgcttgcagatgta
gaatctatcccagctgatatccgccaagcgcttatcaacaacggtggtggacacttgaac
cacgctcttttctgggaattgatgactcctgaaaaaacagctccttcagcagaacttgca
gcagcaatcgatgcagctttcggttcatttgaagaattccaagcagcctttactgcagcg
gctacaacacgcttcggttctggatgggcatggttggttgttaacaaagaagggaagctt
gaagtgacttcaacagcaaaccaagatacaccaatctcagaagggaagaaaccaatcttg
ggcttggatgtttgggaacatgcctactacgtgaaataccgcaatgtacgtcctgattac
atcaaagctttcttctcagtaattaactggaacaaagttgatgagctttacgcagcagct
aaataa

DBGET integrated database retrieval system