KEGG   Streptococcus sp. I-G2: N596_02430Help
Entry
N596_02430        CDS       T02879                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sig  Streptococcus sp. I-G2
Pathway
sig00010  Glycolysis / Gluconeogenesis
sig00020  Citrate cycle (TCA cycle)
sig00620  Pyruvate metabolism
sig01100  Metabolic pathways
sig01110  Biosynthesis of secondary metabolites
sig01120  Microbial metabolism in diverse environments
sig01130  Biosynthesis of antibiotics
sig01200  Carbon metabolism
Module
sig_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N596_02430
   00020 Citrate cycle (TCA cycle)
    N596_02430
   00620 Pyruvate metabolism
    N596_02430
Enzymes [BR:sig01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     N596_02430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-GeneID: 17315722
NCBI-ProteinID: AGY39676
UniProt: U5PBE3
LinkDB All DBs
Position
467599..468642
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLAFLPENIEKDTIKSPAQIEKVEEVPDNVTPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYDVDMSQMLALRKKVLDPIMEATGKKVTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMTLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSATVEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISMLV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgataagctaagagcgactcctgcggctagaaaattagcggatgatctaggg
atcaacctctatgatgtttctggttcaggcgcaaacggtcgtgtccacaaagaagacgtg
gaaacatataaagacacaaatgtggttcgcatttcaccacttgcaaaacgaattgcttta
gaacacaatattgcttggcaagaaattcaaggaactggtcatcgtggtaagatcatgaag
aaggatgttcttgctttccttcctgagaatattgagaaggataccattaagtcgcctgct
caaattgagaaggtggaagaagttcctgataatgttacaccttatggtgagatcgagcgc
attccgatgacaccaatgcgtaaggtgattgcgcaacggatggtggaatcttacttgaca
gcaccaacctttacattgaactatgacgtcgatatgtctcaaatgttggcgcttcgtaag
aaggtattggatccaatcatggaagcaactggtaagaaagtcactgtaacagatttgctt
tctcttgcagttgttaagaccttgatgaaacacccatacatcaatgcgtcattgacggag
gatggcaaaaccatcatcactcacaactatgtcaacttggctatggcggttgggatggac
aatggcttgatgacaccggttgtctataacgcagaaaagatgactttgtcagaattggtg
gtagcctttaaggatgttatcggacgtactttggacggtaagttagctccaagtgaattg
caaaattcaacctttaccatcagtaacttgggaatgtttggtgttcaatcatttggaccg
attatcaaccaaccaaactcagccatccttggggttagcgcaactgttgaaaaaccagtt
gttgtgaatggtgaaatcgtcattcgtccaatcatgagcttgggattgaccattgaccac
cgcgttgtcgatggtatggctggtgccaaattcatgaaagacttgaaagccttgattgaa
gacccgatttcaatgttggtctaa

DBGET integrated database retrieval system