KEGG   Streptococcus sp. I-G2: N596_04280Help
Entry
N596_04280        CDS       T02879                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sig  Streptococcus sp. I-G2
Brite
Translation factors [BR:sig03012]
 Eukaryotic Type
  Elongation factors
   N596_04280 (tuf)
 Prokaryotic Type
   N596_04280 (tuf)
Mitochondrial biogenesis [BR:sig03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    N596_04280 (tuf)
Exosome [BR:sig04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   N596_04280 (tuf)
  Exosomal proteins of breast cancer cells
   N596_04280 (tuf)
  Exosomal proteins of colorectal cancer cells
   N596_04280 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 17316092
NCBI-ProteinID: AGY40019
UniProt: U5P8F1
LinkDB All DBs
Position
complement(853245..854441)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIIMDLMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGIV
KVNDEIEIVGIKEKIQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGIQRDEIERGQVIAKP
GSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTIDVELIHPIAVEKGTTFSIREGGRTVGSGMVTEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtactatcggacac
gttgaccacggtaaaactaccctaactgcagctatcacaactgttttggcacgtcgcttg
ccttcatcagttaaccaaccaaaagactatgcgtctatcgatgctgctccagaagaacgc
gaacgcggtatcaccatcaacactgcgcacgttgagtacgaaactgaaaaacgtcactat
gctcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgctgcc
caaatggacggagctatccttgtagtagcttctacagatggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaggttggtgttaaacacttgatcgtcttcatgaacaaa
gttgacttggttgacgatgaagaattgcttgaattggttgaaatggaaatccgtgacctt
ctttcagaatacgatttcccaggtgatgaccttccagttatccaaggttcagctcttaaa
gctcttgaaggtgattctaaatacgaagacatcatcatggacttgatgaacactgttgat
gagtacatcccagaaccagaacgcgatactgacaaaccattgcttcttccagtcgaagac
gtattctcaatcactggacgtggtactgtagcatcaggacgtatcgaccgtggtatcgtt
aaagtcaacgacgaaatcgaaatcgttggtattaaagaaaaaatccaaaaagcggttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgcaggggacaacgttggt
gtgcttcttcgtggtatccaacgtgatgaaatcgaacgtggacaagttattgctaaacca
ggttcaatcaaccctcacactaaattcaaaggtgaagtttatatccttactaaagaagaa
ggtggacgtcacactccattcttcaacaactaccgtccacagttctacttccgtacaact
gacgtaactggatctatcgaacttcctgctggaactgaaatggtaatgcctggtgataac
gtgactatcgacgttgagttgatccacccaattgccgttgaaaaaggtactacattctct
atccgtgaaggtggacgtactgttggttcaggtatggttactgaaatcgaagcttaa

DBGET integrated database retrieval system