KEGG   Streptococcus sp. I-G2: N596_05350Help
Entry
N596_05350        CDS       T02879                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sig  Streptococcus sp. I-G2
Pathway
sig00220  Arginine biosynthesis
sig00250  Alanine, aspartate and glutamate metabolism
sig00290  Valine, leucine and isoleucine biosynthesis
sig01100  Metabolic pathways
sig01110  Biosynthesis of secondary metabolites
sig01130  Biosynthesis of antibiotics
sig01210  2-Oxocarboxylic acid metabolism
sig01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sig00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N596_05350
   00290 Valine, leucine and isoleucine biosynthesis
    N596_05350
   00220 Arginine biosynthesis
    N596_05350
Enzymes [BR:sig01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     N596_05350
    2.6.1.66  valine---pyruvate transaminase
     N596_05350
Amino acid related enzymes [BR:sig01007]
 Aminotransferase (transaminase)
  Class I
   N596_05350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Alliinase_C Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-GeneID: 17316306
NCBI-ProteinID: AGY40228
UniProt: U5P9E6
LinkDB All DBs
Position
complement(1080932..1082146)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSVKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYSQLKKIPNVEIDDIYIGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYVCDEEAEWYPDIEDIKSKITSNTKAIVVINPNNP
TGALYPDEVLLEIVEIARQHGLIIFADEIYDRLVMDGAKHTAIASLAPDLFCVSMNGLSK
SHRIAGFRVGWMVLSGPKHHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
LPGGRIYEQRNFIYKAINDIPGLSAVKPKAGLYIFPKIDREMYRVDDDEQFVLEFLKQEK
VLLVHGRGFNWKEPDHFRIVYLPRVEELAQIQEKMTRFLKQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatacaataagtccgtcaagctagagcacgttgcttacgatattcgtggtcca
gtattagaagaagcgatgcgcatgcgggcaaacggggagaaaatccttcgcttaaataca
ggaaatccggctgaatttggtttcacggctcccgatgaagtcattcatgatttgattatg
aatgctcgggatagtgaagggtattcagattcaaaaggaattttttctgcccgtaaggca
attatgcagtatagccaattgaaaaagattccgaatgttgagattgatgacatttatatt
ggaaatggtgtcagtgagctaatcgtgatgtctatgcaaggcttgttggataatggcgat
gaagtacttgtaccgatgccagactatcctctatggacagcagcggtcagcctagcaggt
ggtaatgcagtgcactatgtctgtgatgaagaggctgagtggtatcctgatattgaagat
atcaagtcaaaaatcacttcaaacaccaaggctatcgtcgtgatcaatcccaataacccg
accggggctctctatccagatgaggtgttgttggaaatcgtcgagattgcgcgccaacat
ggcttgattatctttgcggatgaaatctatgatcgcttggtcatggatggtgctaaacat
acagccattgccagcctggctccagatttgttctgtgtcagcatgaacggtttgtccaaa
tcacaccgcatcgcgggcttccgtgtgggctggatggttttgtctggacccaaacaccat
gtgaaaggctatatcgaaggtttgaacatgctctctaatatgcgcctgtgttcaaacgtc
ttggctcaacaagtggttcagacttctttgggaggctaccagtcagtggacgaactcttg
cttccaggtggtcgaatctacgaacaacggaactttatctataaggccatcaatgatatt
ccaggactctcagctgtcaaaccaaaagccggtctctatatcttccctaagattgatcga
gaaatgtaccgagtagatgatgatgagcaatttgtcttggaattcttgaaacaagaaaag
gttcttttggttcacggacgtggattcaactggaaagagccagatcatttccggatcgtt
taccttcctcgagtagaagaattggctcaaattcaagagaagatgacccgtttcttaaaa
caatacaaacgataa

DBGET integrated database retrieval system