KEGG   Sulfolobus islandicus HVE10/4: SiH_0582Help
Entry
SiH_0582          CDS       T01952                                 

Definition
(GenBank) dehydrogenase complex, dihydrolipoamide acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
sih00010  Glycolysis / Gluconeogenesis
sih00020  Citrate cycle (TCA cycle)
sih00620  Pyruvate metabolism
sih01100  Metabolic pathways
sih01110  Biosynthesis of secondary metabolites
sih01120  Microbial metabolism in diverse environments
sih01130  Biosynthesis of antibiotics
sih01200  Carbon metabolism
Module
sih_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_0582
   00020 Citrate cycle (TCA cycle)
    SiH_0582
   00620 Pyruvate metabolism
    SiH_0582
Enzymes [BR:sih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SiH_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT Peptidase_M23 Transferase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ADX81941
UniProt: F0NNI3
LinkDB All DBs
Position
complement(566529..567713)
Genome map
AA seq 394 aa AA seqDB search
MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKITTAVKAAASGILLKIY
AKEGEEVPVGQIIAYIGEIGEKPPTLSTKPTLVTEQQQEQPTRVEEAKAISEVRASPRAR
RLAKEKGIDLVKIKGTGPGGMITEDDVIRELENIEKGVKFTATGLRVKEVIPMTAIRQEI
SRRMVQSLQTMAQVTLNIEINANSLVKIKNEVESKYSMKITYTDVLVKVVAKLIRSHPFL
NATLEGDQIKIIEDVNIGIAVALDQGLIVPVIRNADIKPITEIAKESHELADKARENKLN
PDEVTEGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRNAPVVIGDNISIGYVMWLSL
TFDHRVLDGHTAAKFLKELTEILEDENRLRAFLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaagtattaatgccaaagttaggtttaacaatgactaaagggaaaatagtt
caatggaagaaaaaagaaggagatagagttcaagaaggagaggacttagtaataatagaa
actgagaaaataacaactgcagtaaaagcagcagctagcggtatcttacttaagatttac
gccaaagaaggtgaagaggtacctgttggtcaaataatagcgtacataggtgaaattgga
gaaaaacctccaaccttatctactaaacccactttggttactgaacagcaacaagagcaa
ccaacacgagttgaagaggccaaggcaataagtgaagtaagagcttcacctagagctaga
aggcttgctaaagaaaaaggaatagatctagttaaaataaaggggactggacctggaggt
atgataacagaagatgatgtaattagagagttagaaaatattgaaaaaggagtgaaattc
actgccactggtcttagagttaaagaagtgataccaatgactgcgataaggcaagaaata
agtagaagaatggttcagagtcttcagacaatggctcaagtgacactaaatattgagatt
aatgcaaattcgttagttaaaataaaaaatgaagtagagtctaagtatagcatgaaaatt
acttatacagacgttctagttaaagtagtagctaaactcatcagaagtcatccatttcta
aacgcaacactagagggcgatcaaataaagataattgaggatgttaatataggaatagct
gtggctctagatcaaggattaatagtaccagtaataaggaacgcagatattaagccaatt
actgaaatagcaaaagaaagtcatgaactagcggataaggctagagaaaacaagttaaat
cctgacgaagtaacagaaggaacgtttacgataagtaatttaggaatgtatgatatagat
tcatttacaccaattataaatcctcctcaaactgctatattgggagtaggtaggataaga
aatgcaccagttgtaataggcgataatatctcaatcggttacgttatgtggttaagttta
acatttgatcatagagtgttagatggacataccgctgctaagttcttgaaagagcttact
gaaatattagaggatgagaatagattgagagcgtttttaagttag

DBGET integrated database retrieval system