KEGG   Sulfolobus islandicus L.D.8.5: LD85_0069Help
Entry
LD85_0069         CDS       T01158                                 

Definition
(GenBank) protein of unknown function DUF557
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00620  Pyruvate metabolism
sii00680  Methane metabolism
sii00720  Carbon fixation pathways in prokaryotes
sii01100  Metabolic pathways
sii01120  Microbial metabolism in diverse environments
sii01200  Carbon metabolism
Module
sii_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LD85_0069
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_0069
   00680 Methane metabolism
    LD85_0069
Enzymes [BR:sii01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LD85_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADB85873
UniProt: D2PDY7
LinkDB All DBs
Position
61097..62632
Genome map
AA seq 511 aa AA seqDB search
MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTH
VVRKLLSNYPDYFREHILGKDVFLTYRLPNPKVEGADRKVFAETMESIPITYDLAEKFYG
NGITVPVFEVILPMTTSNLEIISVARYYEKAVANEDELELYDGVKVKDLVGEIYPKVIEV
IPLVEERDSLQNIDNIVEGYYKVIKPKYMRVFLARSDPAMNYGMITAVLSVKIALSELYK
LSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSA
ISSINNSRIGPAKILEKYEEDVLRKITILYTERYQPIIESLANAINDVSVLLPRRRARKL
HIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGISSLSNLDEKEWDIFKQNYVNFK
HDLQTAARFFNWESFELIKDIWKISEDTIAKIKEDIDYAESVIGIKLGGIDYDSRKHILM
SSLFLLSFKEKILQESKKYLYEMALIRRSLG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcataccacgtactatgtcaacacaacatcccgataatgcgaaagtaccagag
tgggcaaaaagcgaagttatcgaaggagaagatgaagttaaagaagccttcctagcttat
agtatgtatggagttcatgaggtaatgtgggatgctgagggaaaagacgtagatactcat
gtggtaagaaagttattgtcaaattatccagactactttagagaacatattttaggtaaa
gatgtatttttaacttataggttacctaacccaaaggtggaaggtgctgatagaaaagta
tttgccgaaaccatggagagcattccaataacttatgatttggcagagaaattttacggt
aatgggattacggtaccagtttttgaagtaattttaccaatgacaactagtaatttggag
ataataagtgtggctaggtattacgaaaaagcagttgcaaatgaagatgaactagaactt
tacgatggtgtaaaagtaaaggatttagttggagaaatatatcctaaagtaatagaagtt
ataccactagtcgaagagagggactctcttcaaaatattgacaatatagtggagggatat
tataaggtaattaaacctaagtatatgagagtctttttagccaggtcggatccagcaatg
aattatggaatgataacagctgttctgtcagtaaagattgccttaagtgagttatacaaa
ctttcagaatcgttaaactttgaaatatatccaataattggtgttggttcacttccattt
agaggccatttatctcctgaaaactatgaaaaagtattggaagagtataagggagtttat
acatatacgattcaatcagcgtttaagtatgactatgattacgacaaagtaaaaagtgct
atttcttcaataaataactcacggattggcccagctaaaatattggaaaagtacgaggaa
gatgttctaagaaagataacgatcttatatactgaacgttaccagccaattatagaaagt
cttgcaaacgctataaatgacgtctccgtgttacttcctagaagaagagccagaaaactt
catattggcctttttggatattctagaagcgcaggcaaggttagcttaccaagggcaatt
tctttcgtgggttcactatattcaataggaataccaccagaactaataggaatttcgtct
ttaagcaatttagatgagaaagagtgggatatattcaaacagaattacgttaattttaaa
catgatctacaaactgctgcgagattctttaattgggagtcgttcgaattaattaaggat
atatggaaaattagtgaggatactatagcaaagatcaaggaagatatcgattacgctgag
agcgtgataggcataaaattaggcggcatagattacgatagtagaaaacatatcctaatg
tcttcgctatttttactatcatttaaagagaaaatccttcaagaatctaagaagtattta
tatgagatggcattaattagaagatccttgggatga

DBGET integrated database retrieval system