KEGG   Streptococcus iniae SF1: K710_0605Help
Entry
K710_0605         CDS       T02686                                 

Definition
(GenBank) D-ala D-ala ligase N-terminal domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sik  Streptococcus iniae SF1
Pathway
sik00473  D-Alanine metabolism
sik00550  Peptidoglycan biosynthesis
sik01100  Metabolic pathways
sik01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sik00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    K710_0605
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    K710_0605
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    K710_0605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sik01011]
    K710_0605
Enzymes [BR:sik01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     K710_0605
Peptidoglycan biosynthesis and degradation proteins [BR:sik01011]
 Precursor biosynthesis
  Amino acid ligase
   K710_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AGM98384
LinkDB All DBs
Position
572890..573936
Genome map
AA seq 348 aa AA seqDB search
MAKQTLVLLYGGRSAEREVSVLSAESVMNAINYDKFLVKTYFISQEGEFFKTQSFDQKPL
ASAKLMTNATKDMSQKIKASDIYEKDAVVFPVLHGPMGEDGSIQGFLEILKMPYVGTTIL
SSSVAMDKITTKHVLESAGIPQVAYTVYIEGEDLELAIAESLEKLTFPIFVKPANMGSSV
GISKAETQVELREAIKLALKYDSRILIEQGLVAREIEVGLLGNTQVSSTLPGEVVKDVAF
YDYKAKYVDNKITMAIPAEIEAPIVADMRRYAEQAFRAIGACGLSRCDFFLTEDGKIYLN
ELNTMPGFTQWSMYPLLWENMGMSYSDLIEKLVNLAKEVFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaacattagtattattatatggaggacgttctgctgagcgcgaagtatca
gttctttcagctgaaagcgtcatgaatgctattaattatgacaagtttttggttaagact
tattttatctctcaagaaggggagttcttcaaaacgcaatcatttgatcaaaagccattg
gcctctgctaaattgatgacaaatgcaaccaaggacatgagtcagaaaattaaagccagc
gacatttatgagaaagatgctgttgtttttccagttcttcatggaccgatgggagaagat
ggctcaattcaagggtttttagaaatcttaaaaatgccttatgtgggaacaactattcta
tcatcaagtgttgctatggataaaatcaccacaaaacatgttttagaatcggcaggtatt
ccgcaagttgcttatactgtctatatcgaaggtgaggatttagagttagccattgctgaa
agtttagaaaaacttactttcccaatttttgtcaaaccagcgaatatgggttcttctgtt
ggcatttctaaagctgagacgcaagtagaattaagagaagctattaaattagctcttaaa
tatgatagccgtattttaattgagcaaggactagtggcgcgtgaaatagaagtaggtctt
ttagggaatactcaagtttcttcaactcttcctggtgaagttgttaaagatgttgctttt
tatgattataaagccaaatatgtagacaataagattacaatggcaataccagcagagatt
gaagcaccaattgttgcagacatgcgacgttacgcagaacaagctttcagagcaatcggt
gcttgtggcttgtcacgatgcgatttcttcttaacagaagacggtaagatttacctcaat
gaattaaacaccatgccaggatttactcagtggtctatgtacccactattatgggaaaat
atggggatgagttattctgacttgattgaaaaacttgttaatttagcaaaagaggtcttt
gaaaaacgtgaaagccatctgatataa

DBGET integrated database retrieval system