KEGG   Streptococcus iniae SF1: K710_0784Help
Entry
K710_0784         CDS       T02686                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sik  Streptococcus iniae SF1
Pathway
sik00010  Glycolysis / Gluconeogenesis
sik00020  Citrate cycle (TCA cycle)
sik00620  Pyruvate metabolism
sik01100  Metabolic pathways
sik01110  Biosynthesis of secondary metabolites
sik01120  Microbial metabolism in diverse environments
sik01130  Biosynthesis of antibiotics
sik01200  Carbon metabolism
Module
sik_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sik00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    K710_0784
   00020 Citrate cycle (TCA cycle)
    K710_0784
   00620 Pyruvate metabolism
    K710_0784
Enzymes [BR:sik01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     K710_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B DUF2344
Motif
Other DBs
NCBI-ProteinID: AGM98561
LinkDB All DBs
Position
767322..768737
Genome map
AA seq 471 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDVVNEGDILLEIMSDKTNMEIEAEETGVLLKIV
RQAGDAVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPNSADAAPAVAPKVETEVPEVAV
AKTAIPQEDGAKVRATPAARRVAAELGINLRQVAGTGPFGRVHQDDVENFKNAQPKASPL
ARKMAEAEGLDLADIKGSGYNGKVMKEDILAAILATKPAQETAKPAAAKEELKAELPEGV
EVIKMSAMRKAISKGMTNSYLTAPSFTLNYDIDMTEMMAFRKKLIDPIMNKTGLKVSFTD
LIGMAVVKTLMKPEHKFLNASLINDAQEIELHEFVNIGIAVGLDGGLIVPVVHGADKMSL
ADFVVASKDVIKKAQNGKLKSNEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATI
PTPTVVNGEIVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMENPFELLI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgaaattataatgccaaaactcggtgttgatatgcaagaaggtgaaatcatc
gagtggaaaaaacaagaaggtgatgttgtcaacgagggcgatattcttcttgaaattatg
tctgataaaacaaatatggaaattgaagctgaggagacgggtgttcttttaaaaatcgtt
cgtcaagctggtgatgctgtccctgtaacggaagttattggttacattggagctgaagga
gagtctgtagacacgattgcttcaagtgaaaaaacaactgaaattccagttcctaactca
gctgatgcagcaccggctgttgcgccaaaagtagagactgaagttccagaagttgctgtt
gctaaaacagctatccctcaagaagatggtgccaaagttcgtgcaacacctgctgcaaga
cgtgtagctgcagaacttggtattaacttaagacaagttgctggaacaggtccatttgga
cgtgttcaccaagacgatgttgagaacttcaaaaatgctcaaccaaaagcgtcaccactt
gctcgtaagatggctgaagctgagggtcttgatttggctgacatcaagggaagtggttat
aatggcaaggttatgaaagaagatattcttgctgctattttagctacaaaacctgcacaa
gaaacagctaaaccagcagcagctaaagaagagcttaaagcagaattacctgaaggcgtt
gaagttattaagatgtctgcaatgcgtaaagcaatctctaaaggtatgactaactcatac
ttaacagctccgtcatttacattgaattacgatattgacatgacagagatgatggctttc
cgtaaaaaattaattgatccaatcatgaacaaaacaggtttgaaagtcagctttactgat
ttgattggtatggcagttgtcaaaacattaatgaaacctgagcataagttcctaaatgca
tcattaattaatgacgctcaagaaatcgaacttcatgaatttgttaatattggtatcgcc
gttggtttagacggtggacttattgtaccagttgtacacggtgcagacaaaatgtcactt
gctgattttgttgttgcttctaaagacgttatcaaaaaagcacaaaatggtaagttgaaa
tcaaacgaaatgtcaggatcaacattctcaattacaaacttgggaatgtttggaaccaag
acatttaacccaattattaaccaacctaattctgcaatccttggtgtaggtgcaacgatt
ccaacaccaacagttgttaatggtgaaattgttgcgcgtccaatcatggcaatgtgcttg
accattgaccaccgtatcgtagatggtatgaatggtgctaaattcatggttgatcttaaa
aacttaatggaaaacccatttgaattattaatctga

DBGET integrated database retrieval system