KEGG   Streptococcus iniae SF1: K710_1341Help
Entry
K710_1341         CDS       T02686                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sik  Streptococcus iniae SF1
Brite
KEGG Orthology (KO) [BR:sik00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sik03012]
    K710_1341
   03029 Mitochondrial biogenesis [BR:sik03029]
    K710_1341
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sik04147]
    K710_1341
Translation factors [BR:sik03012]
 Eukaryotic Type
  Elongation factors
   K710_1341
 Prokaryotic Type
   K710_1341
Mitochondrial biogenesis [BR:sik03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    K710_1341
Exosome [BR:sik04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   K710_1341
  Exosomal proteins of breast cancer cells
   K710_1341
  Exosomal proteins of colorectal cancer cells
   K710_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: AGM99106
LinkDB All DBs
Position
complement(1300425..1301621)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPTSVNQPKDYASIDAAPEER
ERGITINTAHVEYETETRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKIDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDEKYEDIVMELMATVDSYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGIKEETQKAIVTGVEMFRKQLDEGLAGDNVGILLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILSKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccccacgttaacattggtacaatcggacac
gttgaccatggtaaaacaactttaacagctgcaattacaactgttcttgcacgtcgttta
cctacttcagttaaccaacctaaagattatgcttctatcgatgctgctccagaagagcgc
gaacgcggaatcacaatcaacactgcacacgttgagtacgaaactgaaactcgtcactat
gcccacatcgatgccccaggacacgcggactatgttaaaaacatgatcactggtgctgcc
caaatggacggagctatccttgttgttgcatcaactgatggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaagttggtgttaaacaccttatcgttttcatgaacaaa
attgaccttgttgatgatgaagaattgcttgaattagttgaaatggaaatccgtgatctt
ctttcagaatacgatttcccaggtgatgaccttccagttatccaaggttcagctcttaaa
gctcttgaaggcgatgaaaaatacgaagacatcgttatggaattgatggctactgttgat
tcatacattccagaaccagaacgtgatactgacaaaccattgcttcttccagttgaggat
gtattctcaatcactggacgtggtactgttgcttcaggacgtatcgaccgtggtactgtt
cgtgtcaacgacgaaatcgaaatcgttggtattaaagaagaaactcaaaaagctatcgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgcaggagacaacgtaggt
atccttcttcgtggtgttcaacgtgacgaaatcgaacgtggacaagttattgctaaacca
ggttcaatcaacccacatactaaatttaaaggtgaagtatacatcctttctaaagaagaa
ggtggacgtcatactccattcttcaacaactaccgcccacaattctacttccgtacaact
gacgtaacaggttcaatcgaacttccagcaggtacagaaatggttatgcctggtgataac
gtgacaatcaacgttgagttgatccacccaatcgccgtagaacaaggtactactttctca
atccgtgaaggtggacgtactgttggttcaggtatcgtttcagaaatcgaagcttaa

DBGET integrated database retrieval system