KEGG   Streptococcus iniae SF1: K710_1654Help
Entry
K710_1654         CDS       T02686                                 

Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sik  Streptococcus iniae SF1
Brite
KEGG Orthology (KO) [BR:sik00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sik01001]
    K710_1654
Enzymes [BR:sik01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     K710_1654
Protein kinases [BR:sik01001]
 Serine/threonine kinases: Other
  Bacterial family
   K710_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo APH RIO1 Kinase-like Haspin_kinase FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AGM99405
LinkDB All DBs
Position
complement(1585191..1587095)
Genome map
AA seq 634 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLANDLILDNEEVAIKVLRTNYQTDQVAVARFQR
EARAMAELNHPNIVAIRDIGEEDGQQFLVMEYIQGADLKKFIQDNAPLSNTQVVRIMEEV
LSAMTLAHQKGIVHRDLKPQNILLTKSGVVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATIQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKTLPSIIDENPQVP
QALENVVIKATAKKLSDRYNSTFEMSRDLMTALSYNRSRERKLVFLDVESTKPLPKVTPT
PAPKPTVAPVSPSNTTKQKQEAIADVPVKKKKSGRFFGTLLKIIFALFVIGVAFFAFLVL
TKPSTVKVPNVNGSSLAVAESELKSLGFKIGKVKEIESATVAEGNVVKTDPEAGTSKREG
SKVDIYVSIGNQSFVMEDYKNQLYEDAVENLVNTYNVPRSKIKIERVVTSDYRKDMVIAQ
SPSPGEKFNPKGKSKIVLSVASNDTVLMPTIVNYTYQDALAALKALGIDSKRVKAYYPDV
NSATGFSKMPNPKSTMIISAQDPYAGVEISLSATSEISIYLYAEEPTANSSDTTTSSNSR
STASSSESHATSSSSSNPNAGTETNTDANVSPQN
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgatacagattggcaaattatttgctggtcgttatcgcatcttaaaatcaattggccgc
ggtggtatggcggatgtttacttagccaatgacttaatcttagataatgaagaagttgca
attaaagttttgcgaaccaattatcaaacagatcaagttgcagtagcgcgtttccaaaga
gaagcgcgagcgatggcagaattaaatcatcccaacattgtcgctattcgagatataggt
gaagaagacggacagcagttcttagtaatggaatatatccagggcgctgaccttaagaaa
tttattcaagataacgctcctttgtctaacacccaagttgttagaatcatggaagaagtt
ttatctgctatgacattagcccaccaaaaagggattgttcatagagacttgaaacctcaa
aatattctattaacaaagtcaggtgttgtcaaagttacagactttggtattgctgtagct
tttgctgaaactagtttaacgcagacaaattccatgttaggaagtgtgcattatttatca
ccagaacaagcccgtggttcaaaagccaccattcaaagtgatatttatgccatgggaatt
atgctctttgaaatgttaacaggtcatatcccatatgatggtgatagtgctgttacaatt
gcattgcagcatttccaaaaaacccttccttcaattattgacgagaacccgcaagttcca
caggctttagaaaatgttgttattaaggcaactgctaaaaagttaagtgatcgttacaat
tcgacatttgaaatgagtcgcgacctaatgactgcactaagttataatcgaagccgtgaa
cgcaagttagtctttttggatgttgaaagcacaaaacccttaccaaaagtaaccccgacc
ccagcaccaaaaccaacggtagctccggtaagtccaagtaataccactaaacaaaaacaa
gaagccattgctgatgtgcctgttaagaaaaaaaagagtgggcgtttctttggaacttta
ttaaagattatttttgcactatttgttatcggtgttgcgttttttgcctttcttgtcttg
accaagccatctaccgtaaaagttccaaatgttaatggaagtagtctagcggttgctgaa
tcagagttaaaatctttagggtttaagattggaaaagtaaaagaaattgagagtgcaacc
gttgcagaaggtaatgttgttaaaacagatccagaagctggaacttcaaaacgcgaaggc
tctaaggttgatatttatgtttcaataggtaatcagagttttgtgatggaagattataaa
aatcaactttacgaagatgccgttgaaaaccttgttaacacctacaatgttccaaggtcg
aaaattaaaattgaaagagtggtaacatccgactatcgtaaggatatggttattgcccag
tcacctagtccaggtgagaaatttaatcccaaaggaaaatcgaagattgtcctcagtgtg
gctagtaatgacacagttttaatgccaactattgttaactatacttatcaggatgccctt
gcagcactaaaagctttaggaattgacagtaagcgtgtcaaagcttattatcctgatgtt
aactctgctactggctttagcaagatgcctaatccaaaatcaacaatgattatcagcgca
caagatccatatgcaggtgtagagatttccttatctgctactagcgagattagcatttac
ctttatgctgaagaaccaacagccaatagttctgatacaacaacatcatcaaacagtcga
agtacagcatcaagtagtgagagtcatgccacaagcagctcatcctctaaccctaacgca
ggtaccgaaacaaacaccgatgccaatgtatcacctcaaaactaa

DBGET integrated database retrieval system