KEGG   Streptococcus iniae SF1: K710_1690Help
Entry
K710_1690         CDS       T02686                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sik  Streptococcus iniae SF1
Pathway
sik00030  Pentose phosphate pathway
sik01100  Metabolic pathways
sik01110  Biosynthesis of secondary metabolites
sik01120  Microbial metabolism in diverse environments
sik01130  Biosynthesis of antibiotics
sik01200  Carbon metabolism
sik01230  Biosynthesis of amino acids
Module
sik_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sik00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    K710_1690
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    K710_1690
Enzymes [BR:sik01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     K710_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-ProteinID: AGM99441
LinkDB All DBs
Position
complement(1622986..1624971)
Genome map
AA seq 661 aa AA seqDB search
MTFDAVDQLAVNTVRTLSMDAIQAANSGHPGLPMGAAPMAYVLWNKFMNVNPKTSRNWTN
RDRFVLSAGHGSAMLYSLLHLAGYDLSIDDLKNFRQWGSKTPGHPEVNHTDGVEATSGPL
GQGIANALGFAMAEAHLAAKYNKPGFDIVDHYTYAINGDGDLMEGVSQEAASLAGHLKLG
KLVLLYDSNDISLDGPTSMAFTEDVKGRFEAYGWQHILVKDGNDLEAIAKAIEEAKAETQ
KPTIIEVKTIIGFGAEKQGTSAVHGAPLGADGIAFAKQSYGWTEQDFTVPAAVEKRFADG
LQARGQEAENAWNDLFAKYEEEYPELAKDYKEAFANQAVSVDLEAHELGTSKASRVSSQE
AIQQISAQVSSFWGGSADLSASNNTMVKVEKDFQPGQFEGRNIWFGVREFAMAAAMNGIA
LHGGTRVYGGTFFVFSNYLLPAVRMAALQNLPTMYVMTHDSIAVGEDGPTHEPIEQLASV
RSMPNLNVIRPADGNETNAAWKRAMAETDRPTMLVLTRQNLPVLEGTKELAADGINKGAY
ILSEAKGDLDGIIIATGSEVKLAMDTQAALEAEGIFVRVVSMPSQNIFDEQSAEYKEEVL
PKAVTKRLAIEAASSFGWAKYVGLQGQTLTIDTWGASAPGNLIFEEYGFTTENAVNRYKS
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgatgcagttgaccagttagcagttaacactgtccgcacgctttcaatggat
gcaatccaagcagcaaattcaggacaccctggcttaccaatgggtgcagccccaatggct
tacgttttatggaataaattcatgaatgtgaatccaaagacaagccgtaactggacaaac
agagaccgtttcgtactttctgcaggtcatggaagtgctatgctatacagcttattgcac
ctagcaggttacgacctttcaattgacgatttgaaaaatttccgtcaatggggatcaaaa
acaccaggacacccagaagtaaatcacacagatggtgtagaagcaactagtggcccccta
ggacaagggattgcaaatgcactaggttttgcaatggcagaagctcaccttgcagctaaa
tacaataaaccaggatttgacattgttgaccattatacttatgccattaatggagatggt
gacttgatggaaggtgttagtcaagaagcagcaagtttagcaggtcacttaaaacttggc
aaattagtgcttttatatgattcaaatgacatctcacttgatggaccaacatcaatggca
ttcacagaagatgttaaaggacgttttgaagcatacggctggcaacatatccttgttaaa
gatggtaatgatttagaagcaattgcaaaagcaattgaagaagcaaaagctgagacacaa
aaaccaactatcattgaagttaagacaattattggatttggtgcagaaaaacaaggcaca
tcagctgttcatggtgcaccactaggtgctgatggcattgcatttgcgaaacaatcatac
ggatggactgaacaagactttacagtaccagcagcagttgaaaaacgttttgctgatggc
ttacaagcacgtggtcaagaagctgaaaatgcatggaatgacctctttgcaaaatatgaa
gaagagtatccagaattagctaaagactataaggaagcttttgcaaatcaagctgtttca
gttgatttagaagcacacgaacttggtacatcaaaagctagtcgtgtctcaagtcaagaa
gctatccaacaaatttcagcacaagtttcttctttctggggcggttcagctgacctttca
gcttcaaataacacaatggttaaagttgaaaaagacttccaacctggacaatttgaaggc
cgcaacatctggtttggtgttcgtgaatttgcaatggcagcagctatgaatggtattgcc
cttcacggtggaacacgtgtttacggtggaacattctttgtcttttcgaactacctatta
ccagcagttcgtatggctgctcttcaaaacttaccaaccatgtatgtgatgacacatgac
tcaattgctgtaggtgaagatggcccaacacatgaaccaattgaacaattggcaagtgtt
cgttcaatgcctaatttaaacgttattcgtcctgcagatggaaatgaaacaaatgcagcg
tggaaacgtgcgatggctgaaacagatagaccaactatgcttgttctaacacgtcaaaac
ttacctgttcttgaaggaacaaaagaattggctgctgatggtattaataaaggtgcttat
attctttcagaagctaagggagatcttgatggtatcattattgcaacaggttcagaagtc
aaattagctatggatacacaagctgcacttgaagcagaaggtatctttgttcgtgtggta
tcaatgccatcacaaaatatctttgatgagcaatctgctgaatacaaagaagaagtgctt
ccaaaagctgtgacaaaacgcctagcaattgaagcagcatcaagctttggttgggctaaa
tatgtcggtttacaaggtcaaacccttaccattgacacttggggagcatctgcaccagga
aaccttatttttgaagaatatggtttcacaactgaaaatgcagtaaaccgttataaatca
ttataa

DBGET integrated database retrieval system