KEGG   Streptococcus iniae SF1: K710_1696Help
Entry
K710_1696         CDS       T02686                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
sik  Streptococcus iniae SF1
Pathway
sik00564  Glycerophospholipid metabolism
sik01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sik00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    K710_1696
Enzymes [BR:sik01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     K710_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGM99447
LinkDB All DBs
Position
complement(1630880..1632709)
Genome map
AA seq 609 aa AA seqDB search
MEFSKETRRLALQKMQERTLDLLIIGGGITGAGVALQAAASGLDTGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQRIAPHIPKPDPMLLPVYDEPGSTFNMFRL
KVAMDLYDLLAGVSQTDLANKVLSKEDVLARQPDLQKEGLLGGGVYLDFRNNDARLVIEN
IKRANQDGALLASHVKAEDFLLDDQGKVCGVKARDLITNQEILIKARLVINTTGPWSDDI
RNFAKTGNKIQQLRPTKGVHLVVDRQKLNVSQPVYVDTGLNDGRMVFVLPREEKTYFGTT
DTDYTGDLKNPKVTQEDVDYLLDIVNRRFPEANLSIDDIESSWAGLRPLLSGNSASDYNG
GNSGKLSDESFTHLITTVESYLNHKESRETVEHAIKAVESSTSEKELDPSAVSRGSSFEC
DDNGLFTLAGGKITDYRKMAEGALDILIKVLNDKYDKQFKLINSTTYPVSGGEINPANVD
SELEAYAQLGALNGLTMDEARYLANLYGSNAPKVFALTRQITAAKGLTLCETLSLHYAMD
YEMALRPTDFFLRRTNHMLFKRTQMDQLIEPVIAEMAKHLSWTEEEKGAYTEELVQNLKD
NDLEELKRK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaaagaaacaagacgtttagcactccaaaaaatgcaagaaagaacctta
gacttgctgattattggtggtgggattacaggagcaggtgttgctcttcaagctgcagcc
agtggactagatactggtctgattgaaatgcaagactttgctgaaggaacatctagccgt
tcaaccaaactggtccatggtgggcttcgctaccttaaacaatttgatgttgaggttgtt
tcggatactgtttcagaacgtgcagttgttcaaaggattgcaccacatattccaaaacca
gatcctatgttattgccagtatatgatgagccaggaagtacttttaacatgttccgtctc
aaagtagcaatggatttatatgacctcttagcaggtgtttctcaaacagacttggctaat
aaagtcttaagtaaagaagacgttctagcgagacagcctgacttgcaaaaagaaggctta
ctaggtggcggtgtttacctagattttagaaataatgatgcccgacttgttattgaaaat
atcaaacgggctaatcaagatggggcactcttagccagtcatgttaaagcagaagatttt
ctattagatgaccaaggaaaagtttgtggtgttaaagcaagagatttgataacaaatcaa
gaaatccttattaaagcgcgtcttgttattaatacaacaggaccttggagtgatgatatc
cggaattttgctaaaacaggcaataagattcagcaactgcgtccgacaaaaggggttcac
ttggttgtagaccgtcaaaaattgaatgtctctcagccagtttatgtggatactggttta
aatgatggtcgtatggtatttgtcttacctcgtgaagaaaaaacatattttggaacaaca
gatactgattatacaggtgatttgaaaaatccaaaagtcactcaagaagacgtggattac
ttgctagatattgtcaaccgtagattcccagaagctaaccttagcattgatgacattgaa
agttcatgggctggtttacgaccactcttatctggcaatagtgcttcagactacaatggt
ggtaacagtggcaagttaagtgatgaaagctttacacatcttattactactgttgagtct
tacttaaaccataaggagagtcgcgaaacagttgagcatgctattaaagcagttgaatca
agcacttcagaaaaagaattggatccatcagctgtttctagaggctcaagctttgaatgt
gatgataatggtctctttactttagcaggtggtaaaatcactgactaccgtaagatggca
gaaggagcccttgacatcttaatcaaggtattgaatgacaagtacgataaacagtttaaa
cttatcaattcaaccacttatccagtttctggtggggaaattaaccctgctaatgtggat
tcagagttagaagcttacgcacaattaggagcattaaatggcctaacaatggatgaggct
cgttatttagcaaatctatatggctcaaatgcaccaaaagttttcgcactaacacgtcaa
atcacagctgcaaaagggttgacattatgtgaaaccttgtcacttcattatgctatggat
tatgagatggccttgcgaccaactgatttcttcttaagaagaactaaccacatgctcttt
aagagaactcagatggatcaattaattgagccagtcattgctgaaatggctaagcatttg
tcttggacagaggaagaaaaaggagcctatactgaagagcttgttcaaaatcttaaagat
aatgacttagaagaattaaaaagaaaataa

DBGET integrated database retrieval system