KEGG   Streptococcus iniae SF1: K710_1780Help
Entry
K710_1780         CDS       T02686                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sik  Streptococcus iniae SF1
Pathway
sik00220  Arginine biosynthesis
sik00250  Alanine, aspartate and glutamate metabolism
sik00290  Valine, leucine and isoleucine biosynthesis
sik01100  Metabolic pathways
sik01110  Biosynthesis of secondary metabolites
sik01130  Biosynthesis of antibiotics
sik01210  2-Oxocarboxylic acid metabolism
sik01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sik00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    K710_1780
   00290 Valine, leucine and isoleucine biosynthesis
    K710_1780
   00220 Arginine biosynthesis
    K710_1780
Enzymes [BR:sik01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     K710_1780
    2.6.1.66  valine---pyruvate transaminase
     K710_1780
Amino acid related enzymes [BR:sik01007]
 Aminotransferase (transaminase)
  Class I
   K710_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AGM99530
LinkDB All DBs
Position
complement(1712683..1713897)
Genome map
AA seq 404 aa AA seqDB search
MKTFNKSSKLEDVAYDIRGPVLEEAERMMANGERILRLNTGNPAAFGFEAPDEVIHDLIV
NARQSEGYSDSKGIFSARKAIMQYCQLKKFPDVDIDDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLAGGKAVHYICDEEADWYPDIDDMKSKITAKTKAIVVINPNNP
TGALYPKEILEAIVELAREHGLILFADEIYDRVVMDGGEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKQHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDDLL
LPGGRIFEQRNFIYKAINDIPGLSAVKPQAGLYIFPKIDRHMYRIDDDEQFVLDLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPRVEELANVQEKITRVLHKYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtttaataaatcgtcaaagttagaagatgttgcctacgatattcgtggacca
gttttggaagaagcagaacgtatgatggcaaatggggaaagaatccttcgtttgaataca
ggaaatcctgccgcctttggttttgaagcaccagatgaagttatccatgatttaattgta
aatgctcgccaaagtgaggggtattctgatagtaaggggattttttcggcacgaaaagcc
attatgcagtactgtcagttaaagaagtttccagatgttgatattgatgatatttatcta
ggtaatggcgtttcagaactgatttccatgtctttacaagccttgcttgatgatggtgat
gaggttttggtgccgatgccggattatcctttgtggacagcttgtgttagtttagctgga
ggaaaggctgttcattatatctgtgatgaagaagctgattggtatccagatattgatgat
atgaagtcaaaaataactgcgaaaacaaaagctatcgttgttattaatcctaataatcct
actggagctctttatcctaaagaaatccttgaagctattgttgaacttgctagagaacat
ggtctaattctttttgctgatgaaatttatgaccgtgttgtcatggatggtggtgagcat
attgcaattgccagtttagcgccagatgttttttgtgtttctatgaatggtttgtcaaaa
tcacatcgcattgccggttttcgtgttggatggatggttttatctggtccgaaacaacat
gttaaaggttatattgaaggacttaatatgcttgctaacatgcgcttgtgttctaatgtt
ttggcgcagcaagttgtgcaaacctcgcttggtgggcgacaatctgtagatgatttattg
cttccaggtggccgtatttttgaacaaaggaactttatttataaagcgattaatgacatt
cctggattgtctgctgttaagccacaggcaggactttatatcttccctaaaattgaccgt
cacatgtatcgtattgatgatgatgagcaatttgttttggatttgctgaaacaagagaag
gtgatgttggtgcatggccgaggttttaactggaaagatcctgatcattttagaattgtt
tatctaccaagagtagaagaactggctaatgttcaagaaaaaattacccgtgtcctacac
aagtataaacgttaa

DBGET integrated database retrieval system